Conserved Protein Domain Family
PLN00174

?
PLN00174: PLN00174 
predicted protein; Provisional
Statistics
?
PSSM-Id: 177769
View PSSM: PLN00174
Aligned: 4 rows
Threshold Bit Score: 188.747
Threshold Setting Gi: 162606184
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162606184   1 MYNEPRTFIPNHILVSMGLVSTFMVIICLGYTYKLLQDLSTDTVNPVEVCDKVNQLKVPEYLAHLFLSIAFVIRGWWIVG 80 
162605928   1 MYNEPRTFIPNHILVSMGLVSTFMVIICLGYTYKLLQDLSTDTVNPVEVCDKVNQLKVPEYLAHLFLSIAFVIRGWWIVG 80 
162605814   1 MYNEPRTFIPNHILVSMGLVSTFMVIICLGYTYKLLQDLSTDTVNPVEVCDKVNQLKVPEYLAHLFLSIAFVIRGWWIVG 80 
160331389   1 MFNKQRTSISNNFLAALGYFCMAIISSCLGCSYKLLKDLSTDTVSPMEICEKINNLKVPEYLAHFILSGVLTLRGWWGIG 80 
162606184  81 FLNFPFIFYNFAQWYEGKHQLDSAQIFNVLSRELRVIKAKSAFFIIIVIYTIWEWMIWVPPDYVSAGEGYHVVKQIQVSH 160
162605928  81 FLNFPFIFYNFAQWYEGKHQLDSAQIFNVLSRELRVIKAKSAFFIIIVIYTIWEWMIWVPPDYVSAGEGYHVVKQIQVSH 160
162605814  81 FLNFPFIFYNFAQWYEGKHQLDSAQIFNVLSRELRVIKAKSAFFIIIVIYTIWEWMIWVPPDYVSAGEGYHVVKQIQVSH 160
160331389  81 IFNVPFIFYNFAQWCEGRHLLDHKKVFSTLSQEMRIIKAKASFFGMVMFYCIWEWATWSPPDYTPIGIGFNTMKNIQVSH 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap