Conserved Protein Domain Family
PLN00172

?
PLN00172: PLN00172 
ubiquitin conjugating enzyme; Provisional
Statistics
?
PSSM-Id: 177768
View PSSM: PLN00172
Aligned: 8 rows
Threshold Bit Score: 273.934
Threshold Setting Gi: 162605924
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162605924   1 MATKRIQKEHKDLLKDPPSNCSAGPSDENLFRWTASIIGPSDSPYAGGVFFLSILFPPDYPFKPPKVQFTTKIYHPNINS 80 
162605640   1 MATKRIQKEHKDLLKDPPSNCSAGPSDENLFRWTASIIGPSDSPYAGGVFFLSILFPPDYPFKPPKVQFTTKIYHPNINS 80 
162605966   1 MATKRIQKEHKDLLKDPPSNCSAGPSDENLFRWTASIIGPSDSPYAGGVFFLSILFPPDYPFKPPKVQFTTKIYHPNINS 80 
162606296   1 MATKRIQKEHKDLLKDPPSNCSAGPSDENLFRWTASIIGPSDSPYAGGVFFLSILFPPDYPFKPPKVQFTTKIYHPNINS 80 
162606598   1 MATKRIQKEHKDLLKDPPSNCSAGPSDENLFRWTASIIGPSDSPYAGGVFFLSILFPPDYPFKPPKVQFTTKIYHPNINS 80 
160331607   1 MATKRIQKELKDLMKDPPSNCSAGPIGDNLFKWTASIIGPGDSPYSGGVFFLGITFPTDYPFKPPKVQFITRIYHPNINS 80 
160331255   1 MATKRIQKELKDLMKDPPSNCSAGPIGDNLFKWTASIIGPGDSPYSGGVFFLGITFPTDYPFKPPKVQFITRIYHPNINS 80 
160330949   1 MATKRIQKELKDLMKDPPSNCSAGPIGDNLFKWTASIIGPGDSPYSGGVFFLGITFPTDYPFKPPKVQFITRIYHPNINS 80 
162605924  81 NGSICLDILRDQWSPALTVSKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAREWTQRYAT 147
162605640  81 NGSICLDILRDQWSPALTVSKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAREWTQRYAT 147
162605966  81 NGSICLDILRDQWSPALTVSKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAREWTQRYAT 147
162606296  81 NGSICLDILRDQWSPALTVSKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAREWTQRYAT 147
162606598  81 NGSICLDILRDQWSPALTVSKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAREWTQRYAT 147
160331607  81 NGNICLDILRDQWSPALTISKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAQEWTQRYAT 147
160331255  81 NGNICLDILRDQWSPALTISKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAQEWTQRYAT 147
160330949  81 NGNICLDILRDQWSPALTISKVLLSISSLLTDPNPDDPLVPEIARVFKENRSRYEATAQEWTQRYAT 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap