Conserved Protein Domain Family
PLN00169

?
PLN00169: PLN00169 
CETS family protein; Provisional
Statistics
?
PSSM-Id: 177765
View PSSM: PLN00169
Aligned: 14 rows
Threshold Bit Score: 356.426
Threshold Setting Gi: 297800000
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115466522   3 GSGRDrDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGGNDMRTFYTLVMVDPDAPSPSDP 82 
115466520   3 GSGRD-DPLVVGRIVGDVLDPFVRITNLSVSYGARIVSNGCELKPSMVTQQPRVVVGGNDMRTFYTLVMVDPDAPSPSNP 81 
15237061    1 MSLSRrDPLVVGSVVGDVLDPFTRLVSLKVTYGHREVTNGLDLRPSQVLNKPIVEIGGDDFRNFYTLVMVDPDVPSPSNP 80 
15218709    1 MSINIrDPLIVSRVVGDVLDPFNRSITLKVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNP 80 
224098778   1 -MSRDrDPLSVGRVIGDVLDPFTKSISLRVTYSSREVNNGCELKPSQVANQPRVDIGGEDLRTFYTLVMVDPDAPSPSDP 79 
224112393   1 -MPRDrEPLSVGRVIGDVLDPFTRSISLRVNYNSREVNNGCELKPSHVVNQPRVDIGGEDLRTFYTLVMVDPDAPSPSNP 79 
242092038   3 GSGRErETLVVGRVVGDVLDPFVRTTNLRVSYGTRTVSNGCELKPSMVVNQPRVEVGGPDMRTFYTLVMVDPDAPSPSDP 82 
255547454   1 -MSRDrDPLVVGRVIGQVLDPFVRSISLQVTYSTKVVNNGCELKPYQVVNQPRVDIGGDDLRTFHTLVMVDPDAPNPSDP 79 
255575302   1 -MPRVrDPLVVGGVIGDILDPFTKSISLSITYSNKDVNNGYELKPSQVVNQPRVDIGGDDLRTFYTLVMVDPDAPSPSDP 79 
297838077   1 MSINIrDPLIVSRVVGDILDPFNRSISLRVTYGQREVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTLVMVDPDVPSPSNP 80 
115466522  83 NLREYLHWLVTDIPGTTAASFGQEVMCYESPRPTMGIHRLVFVLFQQLGRQTVYAPGWRQNFNTKDFAELYNLGSPVAAV 162
115466520  82 NLREYLHWLVTDIPGTTGATFGQEVMCYESPRPTMGIHRLVFVLFQQLGRQTVYAPGWRQNFSTRNFAELYNLGSPVATV 161
15237061   81 HQREYLHWLVTDIPATTGNAFGNEVVCYESPRPPSGIHRIVLVLFRQLGRQTVYAPGWRQQFNTREFAEIYNLGLPVAAS 160
15218709   81 HLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRVVFILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAV 160
224098778  80 SLREYLHWLVTDIPATTGASFGHETVCYESPRPTMGIHRFVFVLFRQLGRQTVYAPGWRQNFNTRDFAEVYNLGSPVAAV 159
224112393  80 NLREYLHWLVTDIPATTGANFGQEVVCYESPRPTAGIHRFVFVLFRQLGRQTVYPPGWRQNFNTRDFAELYNLGSPVAAV 159
242092038  83 NLREYLHWLVTDIPGTTGAAFGQEVICYESPRPTMGIHRFVLVLFQQLGRQTVYAPGWRQNFNTRDFAELYNLGPPVAAV 162
255547454  80 NLREYLHWLVTDIPAMTGASFGQEVVCYESPRPTVGIHRFVFILYRQLGRQTVYAPGWRQNFSAKDFAELYNLGSPVAAV 159
255575302  80 NLREYLHWLVIDIPGTTGATFGQEIVCYESPNPLLGIHRFAFILFRQLGRQTVYAPGWRQNFNTRDFAELYNL-LPVAAL 158
297838077  81 HLREYLHWLVTDIPATTGTTFGNEIVCYENPSPTAGIHRIVVILFRQLGRQTVYAPGWRQNFNTREFAEIYNLGLPVAAV 160
115466522 163 YFNCQREAGSGGRRV 177
115466520 162 YFNCQREAGSGGRRV 176
15237061  161 YFNCQRENGCGGRRT 175
15218709  161 FYNCQRESGCGGRRL 175
224098778 160 YFNCQRESGSGGRRR 174
224112393 160 YFNCQRESGSGGRRP 174
242092038 163 YFNCQREAGSGGRRM 177
255547454 160 YFNCQRETGCGGRRR 174
255575302 159 YFNCQRENRCGGRRS 173
297838077 161 FYNCQRESGCGGRRI 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap