Conserved Protein Domain Family
PLN00166

?
PLN00166: PLN00166 
aquaporin TIP2; Provisional
Statistics
?
PSSM-Id: 165733
View PSSM: PLN00166
Aligned: 7 rows
Threshold Bit Score: 374.659
Threshold Setting Gi: 224137856
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15238100    1 MVKIEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGG 80 
15236043    1 MVKIEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGG 80 
224137856   1 MVKIAFGSLGDSFSVGSLKAYLSEFIATLLFVFAGVGSAIAYSKLTTDAALDPPGLVAVAVAHAFALFVGVSIAANISGG 80 
224071101   1 MAKIAFGSLGDSFSLASLKAYLSEFIATLLFVFAGVGSAIAYSKLTTDAALDPPGLVAVAVAHAFALFVGVSIAANISGG 80 
225466420   1 MVKLAFGSFGDSFSVGSLKAYLSEFNATLLFVFAGVGSAIAYGKLTSDAALDPPGLVAVAIAHAFALFVGVSIAANISGG 80 
297790919   1 MVKIELGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAIAFDKLTSDGALDPAGLVAIAIAHAFALFVGVSIAANISGG 80 
297804452   1 MVKIEIGSLGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVAVAHAFALFVGVSIAANISGG 80 
15238100   81 HLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYAT 160
15236043   81 HLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYAT 160
224137856  81 HLNPAVTFGLAIGGNITILTGLLYWIAQCLGSIAACLLLKFATSAESIPTHGVASGMSAVEGVVMEIVITFALVYTVYAT 160
224071101  81 HLNPAVTFGLAIGGNITFLTGLLYWIAQCLGSIVACLLLKVVTSAEGIPTHGVASGMSAIEGVVMEIVITFALVYTVYAT 160
225466420  81 HLNPAVTFGLAIGGHITILTGIFYVIAQCLGSIVACLLLKFATNGESIPTHGVAAGMNAIEGVVMEIVITFALVYTVYAT 160
297790919  81 HLNPAVTLGLAIGGNITLIIGFFYWIAQCLGSIVACLLLVFVTNGKSVPTHGVAAGLGAVEGIVMEIVVTFALVYTVYAT 160
297804452  81 HLNPAVTLGLAIGGNITVITGFFYWIAQCLGSIVACLLLVFVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYAT 160
15238100  161 AADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSY 240
15236043  161 AADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSY 240
224137856 161 AADPKKGSIGIIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQNWIYWLGPLIGGGLAGLVYGDIFIGSY 240
224071101 161 AADPKKGSLGIIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQNWIYWLGPLVGGGLAGLVYGGIFIGSY 240
225466420 161 AADPKKGSLGIIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSENWIYWVGPLVGGGLAGLVYGNIFIECY 240
297790919 161 AADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSY 240
297804452 161 AADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSY 240
15238100  241 EAVETREIRV 250
15236043  241 APAPTTESYP 250
224137856 241 TAAPVSEDYA 250
224071101 241 APAPVSEDYA 250
225466420 241 ASVPTSDEYA 250
297790919 241 EAVETREIRV 250
297804452 241 APAPTTESYP 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap