Conserved Protein Domain Family
PLN00165

?
PLN00165: PLN00165 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165732
View PSSM: PLN00165
Aligned: 12 rows
Threshold Bit Score: 149.079
Threshold Setting Gi: 225447665
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225447647  1 MSYMGKAWIVTASVGAVEALKDQGFCRWNYAMRSIHQHARNKLRSCSQAQKLSSSSSAMASSRVREEKAKQSEESLRTVM 80 
225447649  1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKTNLRSFTQAKKLSSSSSAMVSSRVRDEKAKQSEESLRTVM 80 
225447651  1 MSHVGKAWLVAASVGAVEALKDQGFCRWNYTLRSIHQHAKTNLRSFAQAKKLSSSSSAMVSSRVREEKAKQSEESLRTVM 80 
225447653  1 MSHMGKAWLVAASVGAVEALKDQGFCRWNYTLRSIHQHAKTNLRSFAQAKKLSSSSSAMVSSRVREEKAKQSEESLRTVM 80 
225447655  1 MSHMGKAWLVAASVGAVEALKDQGFCRWNYTLRSIHQHAKTNLRSFAQAKKLSSSSSAMVSSRVREEKAKQSEESLRTVM 80 
225447657  1 MSHMGKAWIVATSMGAVEALKDQGFCRWNYTMRSLHQHAKNNLRSFSQAKKLSSSSSAMASSRVREDKAKKSEESLRAVM 80 
225447659  1 MSHMRKAWVVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQARKLSSSSSAMVSSRMRDEKAKQSEESLRTVM 80 
225447661  1 MSHMRKAWIVAASVGAVEALKDQGFCRWNYTMRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVRDEKAKQSEESLRTVM 80 
225447663  1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVSSRVRDEKAKQSEESLRTVM 80 
225447665  1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTMRSIHQHARNSLRSFSQVKKL-SSSSAMVSSRVRDEKAKQSEESLRTVM 79 
225447667  1 MSHMGKAWMVAASVGAVEALKDQGFCRWNYTMRSIHQHAKTNLRSFSRAKKLSSSSSAMVSSRVRDEKAKQSEESLRTVM 80 
224145559  1 MSSASKAWLVAAAIGGVEALKDQGFCRWNYTLRSLHHHAKNHVRSASQAKKLSSSSSAMISNIVKEEKAKQSEESLRKVM 80 
225447647 81 YLSCWGPN 88 
225447649 81 YLSCWGPN 88 
225447651 81 YLSCWGPN 88 
225447653 81 YLSCWGPN 88 
225447655 81 YLSCWGPN 88 
225447657 81 YLSCWGPN 88 
225447659 81 YLSCWGPN 88 
225447661 81 YLSCWGPN 88 
225447663 81 YLSCWGPN 88 
225447665 80 YLSCWGPN 87 
225447667 81 YLSCWGPN 88 
224145559 81 YLSCWGPN 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap