Conserved Protein Domain Family
PLN00163

?
PLN00163: PLN00163 
histone H4; Provisional
Statistics
?
PSSM-Id: 165730
View PSSM: PLN00163
Aligned: 3 rows
Threshold Bit Score: 62.0134
Threshold Setting Gi: 159465883
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159465883  1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRTVL 59 
159468412  1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRTVL 59 
224063687  1 MYGCGKGGDGLGEGGAKH----VRDNIQDITKPVTCCLARRGGVKRISGLIYEETRGIL 55 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap