Conserved Protein Domain Family
PLN00160

?
PLN00160: PLN00160 
histone H3; Provisional
Statistics
?
PSSM-Id: 165727
View PSSM: PLN00160
Aligned: 2 rows
Threshold Bit Score: 169.458
Threshold Setting Gi: 219130397
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223995905   1 MRPGEKALREIRQYQSSTSLLLRRLPFARLVREIQYGMTRQPYRWQGSAILALQEAAEAHLVGLFEDSNLCAIHGKRVTI 80 
219130397   8 MRPGQKALKEIKMYQKSTDLLIRRLPFARLVREIQMEMSREAYRWQGTAILALQEASEAHLVSLFEDTNLCALHGKRVTI 87 
223995905  81 MPKDMQLARRIRGWVRE 97 
219130397  88 MPKDMQLARRIRGQTRE 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap