Conserved Protein Domain Family
PLN00157

?
PLN00157: PLN00157 
histone H2A; Provisional
Statistics
?
PSSM-Id: 177758
View PSSM: PLN00157
Aligned: 34 rows
Threshold Bit Score: 202.773
Threshold Setting Gi: 168024840
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219119185   6 PGGKGKGKGGRGDKKQTtSSSSKAGLQFPVGRIGRYLRQGKYATRMGAGAPVYLAAVLEYLCAEILELAGNAARDNKKSR 85 
168024840   1 MSGRGKGAGAAARKKSV-TKSAKAGLQFPVGRLGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNASRDNKKSR 79 
168034353   1 MSGRGKGAGAAARKKSV-TKSAKAGLQFPVGRLGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEVLELAGNASRDNKKSR 79 
225439749   8 KKGAGGRKGGGPKKKPV-SRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKNR 86 
224087383   1 ------RKGGGPKKKPV-SRSAKAGLQFPVGRIGRYLKKGRYSQRVGSGAPVYLAAVLEYLAAEVLELAGNAARDNKKNR 73 
224005030   1 MSGKGK--GGRGEKKQT-SSSAKAGLQFPVGRIGRYLRQGKYATRMGAGAPVYLAAVLEYLCAEILELAGNAARDNKKSR 77 
224004334   1 MSGKGK--GGRGEKKQT-SSSAKAGLQFPVGRIGRYLRQGKYATRMGAGAPVYLAAVLEYLCAEILELAGNAARDNKKSR 77 
255584768   8 KKGAGGRKGGGPKKKPV-TRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNKKNR 86 
255584772   8 KKGAGGRKGGGPKKKPV-TRSVRAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYMAAVLEYLAAEVLELAGNAARDNKKNR 86 
225435042   8 KKGAGGRKGGGPKKKPV-SRSVKAGLQFPVGRIGRYLKKGRYSQRVGTGAPVYLAAVLEYLAAEVLELAGNAARDNKKNR 86 
219119185  86 IVPRHITLAVKNDEELNKLLGNVTIAAGGVLPNIHAILLPKKTIKTKGPSQDY 138
168024840  80 IIPRHIQLAIRNDEELGKLLSGVTIAYGGVLPNIHSVLLPKKTAGGAGADKSE 132
168034353  80 IIPRHIQLAIRNDEELGKLLSGVTIAYGGVLPNIHSVLLPKKTAGGTGTEKPA 132
225439749  87 IIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLPKKSDKAAKEPKSP 139
224087383  74 IIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLPKKTEKAAKEPKSP 126
224005030  78 IVPRHITLAVKNDEELNKLLGGVTIAAGGVLPNIHAVLLPKKSSASK------ 124
224004334  78 IVPRHITLAVKNDEELNKLLGGVTIAAGGVLPNIHAVLLPKKSSASK------ 124
255584768  87 IIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLPKKTEKATKEPTKS 139
255584772  87 IIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPNINPVLLPKKTEKATKEPTKS 139
225435042  87 IIPRHVLLAVRNDEELGKLLSGVTIAHGGVLPNINPVLLPKKTDKATKEPKSP 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap