Conserved Protein Domain Family
PLN00155

?
PLN00155: PLN00155 
histone H2A; Provisional
Statistics
?
PSSM-Id: 165723
View PSSM: PLN00155
Aligned: 2 rows
Threshold Bit Score: 82.0629
Threshold Setting Gi: 159465924
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159465924  1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYL 58 
159481781  1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYL 58 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap