Conserved Protein Domain Family
PLN00154

?
PLN00154: PLN00154 
histone H2A; Provisional
Statistics
?
PSSM-Id: 177756
View PSSM: PLN00154
Aligned: 17 rows
Threshold Bit Score: 204.023
Threshold Setting Gi: 223993459
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145342477   1 MSGKGAKGLSGKGLSGKGAKgtmssKKGDKRKPTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTA 80 
15224957    1 MAGKGGKGLLAAKTTAAAAN-----KDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTA 75 
30687646    1 MAGKGGKGLLAAKTTAAAAN-----KDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTA 75 
30687643    1 MAGKGGKGLLAAKTTAAAAN-----KDSVKKKSISRSSRAGIQFPVGRIHRQLKQRVSAHGRVGATAAVYTASILEYLTA 75 
224143081   1 MSGKGAKGLLTSKTPAQS-------KDKDKKKPTSRSSRAGLQFPVGRIHRLLKSRATAHGRVGATAAVYSAAILEYLTA 73 
224092416   1 MSGKGAKGLLTSKTPAQS-------KDKDKKKPTSRSSRAGLQFPVGRIHRLLKTRATAHGRVGATAAVYSAAILEYLTA 73 
224092420   1 MSGKGAKGLLTSKTPAQS-------KDKDKKKPTSRSSRAGLQFPVGRIHRLLKTRATAHGRVGATAAVYSAAILEYLTA 73 
255083116   1 MSGKGAKGLSGKGLSGKGAKgt--mKGGDKKKPTSRSVKAGLQFPVGRIHRFLKNRAASGGRVGATAAVYSAAILEYLTA 78 
159471111   1 MSGKGAKGLSGKGAKGTMGDk----LKGDKRKPTSRSQKAGLQFPVGRIHRLLKSRVTANGRVGATSAVYAAAILEYLTA 76 
302849396   1 MSGKGAKGLSGKGAKGTMGDk----LKGDKKKPTSRSAKAGLQFPVGRIHRLLKSRVTANGRVGATSAVYAAAILEYLTA 76 
145342477  81 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDMLIKATIAGGGVIPHIHKSLMNKSAKK 141
15224957   76 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD 136
30687646   76 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD 136
30687643   76 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLVNKVTKD 136
224143081  74 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 134
224092416  74 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 134
224092420  74 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSSKE 134
255083116  79 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLINKSSKK 139
159471111  77 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLISKQQKK 137
302849396  77 EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLISKQQKK 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap