Conserved Protein Domain Family
PLN00153

?
PLN00153: PLN00153 
histone H2A; Provisional
Statistics
?
PSSM-Id: 165721
View PSSM: PLN00153
Aligned: 28 rows
Threshold Bit Score: 202.642
Threshold Setting Gi: 159486721
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159464886   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159486721   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476910   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476370   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476358   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476324   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476708   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476690   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159476298   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159469846   1 MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKNRIVP 80 
159464886  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKGEETA 129
159486721  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKNKGGKAEDGS 129
159476910  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKAEDGS 129
159476370  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKAEDGS 129
159476358  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKAEDGS 129
159476324  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKNKGGKAEDGS 129
159476708  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKGSEEA 129
159476690  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKGSEEA 129
159476298  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKAEDGS 129
159469846  81 RHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGGKAEDGS 129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap