Conserved Protein Domain Family
PLN00152

?
PLN00152: PLN00152 
DNA-directed RNA polymerase; Provisional
Statistics
?
PSSM-Id: 177755
View PSSM: PLN00152
Aligned: 26 rows
Threshold Bit Score: 132.3
Threshold Setting Gi: 159484600
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115471967   5 DYNDM-DMGYEDEPPEPEIEEGAEE--EPENNNEDAVDDVVGAEDDKEQEKTARPRKTSKYMTKYERARILGTRALQISM 81 
162606202   1 ----MsEIESLESISSVSVENEVDSe-MISNEFPEKSLNCNENIFKMNDKLDIDFRMTLPILTKYEKARILGARALQISM 75 
159484600   1 ------------------------------QEGEENIELLDHADGQAGQGGGPRQRITTRYMTKYEKARVLGTRALQISM 50 
145343764   1 -------------------------------------------------AVPRHERTTTPYMTKYERARILGTRALQISM 31 
219111697   3 NDGDEdPMEDGTQQIREEDEDGLDI----SGDRDDGGETTIVGIGPDGGGTARSERITTRYLTKYERARVLGTRALQISM 78 
224001376   1 -------------------------------------------------------RITTRYLTKYERARVLGTRALQISM 25 
255082354   6 DYDGGdGAYDYDEPAGGDDEPEAEDa-EMPEGGVEVLEHAPQQGGGAVTE-----RTTTPYMTKYERARILGTRALQISM 79 
160331075   9 DFDSIqAVSEINFSSEEHFFENFNPi-SNSENLMENNYFKNFLKNQEETLSQDK-RKTLPFLTKYEKARILGARALQISM 86 
303281806   1 -------------------------------------------------------RTTTPYMTKYERARILGTRALQISM 25 
302847622   1 MADDFdDAGGMEEPMDLGEEPALEDfaGEAHEGDGNIDILDNQEQQQQQGGGQRQRITTRYMTKYEKARVLGTRALQISM 80 
115471967  82 NAPVMVELEGETDPLEIAMKELRARKIPFTIRRYLPDGSYEDWGVDELIVED 133
162606202  76 GAPILTEVNTLSDSLDIASKELYERKIPITIRRYLPNGRYEDWKIEELIFD- 126
159484600  51 NAPVMVELSGETDPLEIAMKELREKKVPFTIRRYLPD--------------- 87 
145343764  32 NAPVLVQLEGETDPLEIAGKELREKRVPFVVRRYMPDGSYEDWGIDELIV-- 81 
219111697  79 NAPVMVDLDGETDPLRIAEKELRERKIPIIIRRYLPDGSHEDWSVDELVVD- 129
224001376  26 NAPVMVDLEGETDPLKIAQKELRERKIPIVIRRYLPDGSHEDWGIDELIVD- 76 
255082354  80 NAPVLVQLDGETDPLEIAGKELREKRIPFTVRRYLPDGSWEDWGVDELIVED 131
160331075  87 GAPLMIEIEGETDALDIAAKELLKRKIPITLRRYLPNGTFEDWDLDELIIE- 137
303281806  26 NAPVLVQLDGETDPLEIAGKELREKRIPFTVRRYLPDGSFEDWSVDELIIED 77 
302847622  81 NAPVMVELSGETDPLEIAMKELREKKVPFTIRRYLPDGSYEDWSISELVVPD 132
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap