Conserved Protein Domain Family
PLN00149

?
PLN00149: PLN00149 
potassium transporter; Provisional
Statistics
?
PSSM-Id: 177753
View PSSM: PLN00149
Aligned: 10 rows
Threshold Bit Score: 1458.14
Threshold Setting Gi: 297807501
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297841767   1 MEIESGSYQNIAK---------------------------------------KESWRTVLTLAYQSLGVVYGDLSISPLY 41 
15241517    1 MDLERLSPRNPVK---------------------------------------KESWWTVLTLAYQSLGVVYGDLATSPLY 41 
22330543    1 MEIESGSYQN-AK---------------------------------------KESWRTVLTLAYQSLGVVYGDLSISPLY 40 
224099721   1 MDLETGISQNHVK---------------------------------------RESWKTVLTLAYQSLGVVYGDLSTSPLY 41 
224111286   1 MDLESGVFQNHVK---------------------------------------KESWKTVLTLAYQSLGVVYGDLSTSPLY 41 
225452516  22 SQLEGVTSRCMQRcretklqekpetdrelfccslkspplfflvhvvvlfllqRESWRTVLTLAYQSLGVVYGDLSTSPLY 101
225424705   1 MDPEGGVHANHAK---------------------------------------KESWRAVLTLAYQSLGVVYGDLSTSPLY 41 
255552638   1 MDLEG-----------------------------------------------RDSWKTVLTLAYQSLGVVYGDLSTSPLY 33 
255587842   1 --MTKLMFYFCVQ---------------------------------------KESWKTVLTLAYQSLGVVYGDLSTSPLY 39 
297807501   1 MDLERLSPRNPIK---------------------------------------KESWWTVLTLAYQSLGVVYGDLATSPLY 41 
297841767  42 VYKSTFAEDIHHSESNEEIFGVLSFIFWTITLVPLLKYVFIVLRADDNGEGGTFALYSLLCRHARVNSLPSCQLADEQLI 121
15241517   42 VYKSTFAEDITHSETNEEIFGVLSLIFWTLTLIPLVKYVFIVLRADDNGEGGTFALYSLLCRHARISSLPNFQLADEDLS 121
22330543   41 VYKSTFAEDIHHSESNEEIFGVLSFIFWTITLVPLLKYVFIVLRADDNGEGGTFALYSLLCRHARVNSLPSCQLADEQLI 120
224099721  42 VYKSTFADDIQHSETNEEIYGVLSFVFWTLTLIPLLKYVFIVLKADDNGEGGTFALYSLLCRHARVNSLPNCQVADEELY 121
224111286  42 VYKSTFAEDIQHSETNEEIYGVLSFVFWTLTLVPLLKYVFIVLKADDNGEGGTFALYSLLCRHARINSLPNCQVADEELY 121
225452516 102 VYKSTFAEDIHHSETNEEIYGVLSFVFWTLTLIPLLKYVFIVLRADDNGEGGTFALYSLLCRHARVNSIPNCQLADEELS 181
225424705  42 VYKSTFAEDIQHSETNEEIYGVLSFVFWTLTLVPLLKYVFIVLKADDNGEGGTFALYSLLCRHARVNSLPNCQSADEELS 121
255552638  34 VYKSAFAEDIQHSETNEEIYGVLSFVFWTLTLIPLVKYVFIVLRADDNGEGGTFALYSLLCRHARVSSIPNCQLADEELS 113
255587842  40 VYKSTFAEDIQHSETNEEIFGVLSFVFWTLTLVPLLKYVFIVLRADDNGEGGTFALYSLLCRHARVNSLPNCQVADEELY 119
297807501  42 VYKSTFAEDITHSETNEEIFGVLSLIFWTLTLIPLVKYVFIVLRADDNGEGGTFALYSLLCRHARISSLPNFQLADEDLS 121
297841767 122 EYKTDSigSSSSMPQSGFAASLKSTLEKHGVLQKILLVLALIGTCMVIGDGVLTPAISVFSAVSGVELSMSKEHHKYIEL 201
15241517  122 EYKKNS--GENPMRLKVPGWSLKNTLEKHKFLQNMLLVLALIGTCMVIGDGVLTPAISVFSAVSGLELSMSKQQHQYVEV 199
22330543  121 EYKTDSi-GSSSMPQSGFAASLKSTLEKHGVLQKILLVLALIGTCMVIGDGVLTPAISVFSAVSGVELSMSKEHHKYIEL 199
224099721 122 EYKKDAa-ATCLTPKTTFGSRLKSTLEKHRVLQRFLLLLALIGTCMVIGDGVLTPALSVFSAVSGLELSMSREHHKYVEV 200
224111286 122 EYKKDAa-NTCLTPTTAFGLRLKSTLEKHRVLQRFLLLLALIGTCMVIGDGVLTPALSVFSAVSGLELSMAKEHHKYVEV 200
225452516 182 EYTRDG----FVLLDKNSGSSLKSTLEKYRVLQRVLLVLALIGTCMVIGDGVLTPSISVFSAVSGLELSMSKEHHLYVQV 257
225424705 122 EYKKDG---AGSTETPNFGSRLKSALEKHRVLQRFLLVLALIGTCMVIGDGVLTPAISVFSAVSGLELSMEKEHHKSV-I 197
255552638 114 EYKKDG---SVFNDKSGIGSSLKSTLEKCRILQRLLLVLALIGTCMVIGDGVLTPAISVFSAVSGLELSMSKEQHQYVEL 190
255587842 120 EYKKDS---LSPIPNSSFGGRLKSTLEKHRVLQRFLLVLALIGTCMVIGDGVLTPAISVFSAVSGLELSMAKEHHKYVEV 196
297807501 122 EYKKTS--GENLRSLKVPGWSLKNTLEKHKFLQNMLLVLALIGTCMVIGDGVLTPAISVFSAVSGLELSMSKQQHQYVEV 199
297841767 202 PAACIILIGLFALQHYGTHRVGFLFAPVILLWLMCISAIGVYNIFHWNPHVYQALSPYYMYKFLKKTQSKGWMSLGGILL 281
15241517  200 PVVCAILILLFSLQHYGTHRLGFVFAPIVLAWLLCISTIGVYNIFHWNPHVYKALSPYYIYKFLKKTRKRGWMSLGGILL 279
22330543  200 PAACVILIGLFALQHYGTHRVGFLFAPVILLWLMCISAIGVYNIFHWNPHVYQALSPYYMYKFLKKTQSRGWMSLGGILL 279
224099721 201 PVACIILIGLFALQHYGTHRIGFLFAPVVLMWLLCISAIGIYNIIHWNPHVYQALSPYYMYKFLRKTQRGGWMSLGGILL 280
224111286 201 PVACTILICLFALQHYGTHRVGFLFAPVVLMWLLCISAIGIYNIIHWNPHVYQALSPYYMYKFLRKTQRGGWMSLGGILL 280
225452516 258 PVACIILVFLFALQHYGTHRVGFLFAPIVITWLLCISAIGLYNIFHWNPCVYQALSPYYMYKFLKKTQRGGWMSLGGILL 337
225424705 198 PAACIILIGLFALQHYGTHRVGFLFAPVVVTWLFCISAIGLYNIFHWNPHVYRALSPYYMYTFLKKTQRGGWMSLGGILL 277
255552638 191 PVACAILVFLFSLQHYGTHRVGFLFAPVVITWLLCISAIGVYNILHWNPHVYQALSPYYMYKFLKKTQRGGWMSLGGILL 270
255587842 197 PVACIILVALFALQHYGTHRVGFLFAPVVLTWLLCISTIGIYNIVHWNPHVYQALSPYYMYKFLTKTQRGGWMSLGGILL 276
297807501 200 PVVCAILILLFSLQHYGTHRLGFVFAPIVLAWLLCISTIGVYNIFHWNPQVYKALSPYYIYKFLKKTRKRGWMSLGGILL 279
297841767 282 CITGSEAMFADLGHFSQLSIKIAFTSLVYPSLILAYMGQAAYLSQHHVIESEYNIGFYVSVPEKLRWPVLVIAILAAVVG 361
15241517  280 CITGSEAMFADLGHFTQLSIQIAFTFAVYPSLILAYMGQAAYLSKHHVLQSDYRIGFYVSVPEQIRWPVLAIAILAAVVG 359
22330543  280 CITGSEAMFADLGHFSQLSIKIAFTSLVYPSLILAYMGQAAYLSQHHIIESEYNIGFYVSVPERLRWPVLVIAILAAVVG 359
224099721 281 CITGSEAMFADLGHFSQLSIQIAFTSLVYPSLILAYMGQAAYLSQHHAIDSDYRIGFYVSVPDKLRWPVLVIAILAAVVG 360
224111286 281 CITGSEAMFADLGHFSQLSIQIAFTSLVYPSLILAYMGQAAYLSQHHVIDNDYHIGFYVSVPGKLRWPVLVIAILAAVVG 360
225452516 338 CITGSEAMFADLGHFSQLSIQIAFTFVVYPSLILAYMGQAAYLSKHHTIESDYHIGFYVSVPEKLRWPVLGIAILAAVVG 417
225424705 278 CITGSEAMFADLGHFSQLSIKIAFTSVVYPSLILAYMGQAAYLSQHHLIESDYRIGFYVSVPEKLRWPVLVIAILAAVVG 357
255552638 271 CITGSEAMFADLGHFSQLSIKIAFTFVVYPSLILAYMGQAAYLSKHHIIESDYRIGFYVSVPEKIRWPVLAIAILAAVVG 350
255587842 277 CITGSEAMFADLGHFSQLSIKIAFTSLVYPSLVLAYMGQAAYLSKHHFEDRDYRIGFYVSVPGKLRWPVLVIAILAAVVG 356
297807501 280 CITGSEAMFADLGHFTQLSIQIAFTFAVYPSLILAYMGQAAYLSKHHVLESDYRIGFYVSVPEQIRWPVLAIAILAAVVG 359
297841767 362 SQAIITGTFSIIKQCSALGCFPKVKIVHTSSKIHGQIYIPEINWILMILCLAVTIGFRDTKRLGNASGLAVITVMLVTTC 441
15241517  360 SQAIITGTFSIIKQCTSLGCFPKVKIVHTSSRMHGQIYIPEINWTLMLLCLAVTVGFRDTKHISNASGLAVITVMLVTTC 439
22330543  360 SQAIITGTFSIIKQCSALGCFPKVKIVHTSSKIHGQIYIPEINWILMVLCLAVTIGFRDTKRLGNASGLAVITVMLVTTC 439
224099721 361 SQAIITGTFSIIKQCSALSCFPRVKIVHTSSKIHGQIYIPEINWTLMLLCLAVTVGFRDTKRMGNASGLAVITVMLVTTC 440
224111286 361 SQAIITGTFSIIKQCSALGCFPRVKIVHTSSKIHGQIYIPEINWTLMLLCLAVTIGFRDTKRLGNASGLAVITVMLVTTC 440
225452516 418 SQAIITGTFSIIKQCSALGCFPRVKIVHTSSKIHGQIYIPEINWTLMLLCLAITVGFRDTKRLGNASGLAVITVMLVTTC 497
225424705 358 SQAIITGTFSIIKQCSALGCFPRVKIVHTSSKIHGQIYIPEINWILMLLCLAVTIGFRDTNRLGNASGLAVITVMLVTTC 437
255552638 351 SQAIITGTFSIIKQCSSLGCFPKVKIVHTSSKMHGQIYIPEINWTLMLLCLAVTVGFRNTKHMGNASGLAVITVMLVTTC 430
255587842 357 SQAIITGTFSIIKQCSALGCFPKVKIVHTSSKIHGQIYIPEINWTLMLLCLAVTVGFRDTRRLGNASGLAVITVMLVTTC 436
297807501 360 SQAIITGTFSIIKQCTSLGCFPKVKIVHTSSRMHGQIYIPEINWTLMLLCLAVTVGFRDTKHISNASGLAVITVMLVTTC 439
297841767 442 LMSLVIVLCWHKSVLLAIAFVVFFGTIEALYFSASLIKFLEGAWVPIALAFCFLLAMCTWHYGTLKRYEYDVQNKVSVNW 521
15241517  440 LMSLVIVLCWRKSSLYALAFIFFFGTIEVLYFSASLIKFLEGAWVPVALSFIFLLIMYVWHYGTLKRYEFDVQNKVSINW 519
22330543  440 LMSLVIVLCWHKSVIFAIVFVVFFGTIESLYFSASLIKFLEGAWVPIALAFCFLLAMCTWHYGTLKRYEYDVQNKVSVNW 519
224099721 441 LMSLVIVLCWHKNVFFAICFVCFFGTIEALYFSASLIKFLEGAWVPVALSFIFLIVMCVWHYGTLKTYEFDVQNKVSINW 520
224111286 441 LMSLVIVLCWHKTVFLAICFVCFFGTIEALYFSASLIKFLEGAWVPIALSFIFLIVMCVWHYGTLKAYEFDVQNKVSINW 520
225452516 498 LMSLVIVLCWHKSVILAICFIFFFGSIEALYFSASLIKFLEGAWVPIALSFIFLMVMYVWHYGTLKKYEFDVQSKVSINW 577
225424705 438 LMSLVIVLCWHQSVFFAIGFIFFFGTIEALYFSASLIKFLEGAWVPIALAFIFLIVMYVWHYGTLKKYEFDVQNKISINW 517
255552638 431 LMSLVMVLCWHKNVLLAICFIFFFGSIEALYFSASLIKFLEGAWVPIALSFIFLVVMYVWHYGTLKKYEADVQNKVSINW 510
255587842 437 LMSLVIVLCWHKSVFLALCFVFFFGAIEALYFTASLIKFLEGAWVPIALSFIFLIIMCVWHYGTLKKYEFDVQNKVSINW 516
297807501 440 LMSLVIVLCWRKSSLYALAFIFFFGTIEVLYFSASLIKFLEGAWVPVALSFIFLLIMYVWHYGTLKRYEFDVQNKVSINW 519
297841767 522 LLSL--SQTLGIARVRGLGLIHTELVSGVPAIFSHFVTNLPAFHQVLVFLCVKSVPVPHVRPEERFLVGRIGPKEFRIYR 599
15241517  520 LLTLfgSSNLGIVRVHGIGVINTELVSGIPAIFSHFITNLPAFHQVVVFLCVKSVPVPHVKPEERFLVGRVGPKEYRLYR 599
22330543  520 LLSL--SQTLGIARVRGLGLIHTELVSGVPAIFSHFVTNLPAFHQVLVFLCVKSVPVPHVRPQERFLVGRIGPKEFRIYR 597
224099721 521 LLSL--GPSLGIVRVRGIGLIHTELVSGIPAIFSHFVTNLPAFHQVLVFLCIKSVPVPHVRAKERFLIGYIGPREYRLYR 598
224111286 521 LLSL--GPSLGIVRVRGIGLIHTELVSGIPAIFSHFVTNLPAFHQVLVFLCIKSVPVPHVRAKERFLIGHIGPREYRLYR 598
225452516 578 LLGL--GPTLGIVRVRGIGLIHTELVSGIPAIFSHFVTNLPAFHQVLVFLCIKSVPVPHVKPEERFLVGRVGPKEYRLYR 655
225424705 518 LLSL--GPSLGIVRVRGIGIIHTELVSGIPAIFSHFVTNLPAFHQVLVFLCIKSVPVPHVRPEERFLVGHIGPREFRLYR 595
255552638 511 LLSL--GPSLGIVRVRGIGLIHTELVSGIPAIFSHFVTNLPAFHQVVVFLCIKSVPVPHVRPEERFLVGRVGPKEYRLYR 588
255587842 517 LLSL--GPSLGIVRVRGIGLIHTELVSGIPAIFSHFVTNLPAFHQVLVFLCIKSVPVPHVRPEERFLVGHIGPREYRLYR 594
297807501 520 LLTLfgSSNLGIVRVQGIGVINTELVSGIPAIFSHFITNLPAFHQVVVFLCVKSVPVPHVKPEERFLVGRVGPKEYRLYR 599
297841767 600 CIVRFGYRDVHKDDFEFEGDLVCSIAEFIRTEAATAT----------AAETNGEDDDRMSVVGTCSTYMQGIEDHyESDL 669
15241517  600 CIARYGYRDVHKDDVEFENDLICSIAEFIRSDKPLNYs--------pDPENESGINERLTVVAASSSNLEGVQIYeDDGS 671
22330543  598 CIVRFGYRDVHKDDFEFEGDLVCSIAEFIRTEAETAAt---------AAETNGEDDDRMSVVGTCSTYMQGIEDHyESDI 668
224099721 599 CIVRYGYRDVHKDDMEFEKDLVCSIAEFIRSGNHEPNg---------AKDDLESEDGKMTVVGTCCTHTDGIQLR-EDDV 668
224111286 599 CIVRYGYRDVHKDDMEFEKDLVCSIAEYIRTGNAEPNg---------ARDEMESEDDKMTVVGTCCTHTDGIQLR-EDDV 668
225452516 656 CIARYGYRDVHKDDVEFEKDLVCSIAEFIRSEGPEYDtplvqkeefgTGIEGLEKNERMTVVGTSSTQLDGIKLR-E-ES 733
225424705 596 CIVRYGYRDVHKDDLDFEKDLVCSVAESIRSGKVEINg---------VDDNSEKDEEKMTVVGSSSTHPEGIKMC-DDDA 665
255552638 589 CIARYGYRDVHKDDMEFEKDLVCSIAEFIRSEKPESD----------IGIEDVGEYEKMTVIGTLSSSFEGVKMR-EDDT 657
255587842 595 CIVRYGYCDVHKDDMEFEKDLVCSIAEFIRSESMEPNg---------TSNDIVKEDDKMTVVGTCSAHSDGIQLS-EDEV 664
297807501 600 CIARYGYRDVHKDDVEFENDLICSIAEFIRSDKPLNYs--------pDPENESGTSERLTVVAASSSNLEGVQIFeDDGS 671
297841767 670 DDPNKPGTSEIRSPKPKKksKSkiKKRVRFVVPETPKIEKETRQELMELTEAREGGVAYIMGNAYMKAKQGSGLVKRLAI 749
15241517  672 DKQEPSSSSEVIMVAPSP--RF--KKRVRFVLPESARIDRSAEEELTELTEAREAGMAFIMGHSYVRAKSGSSVMKKIAI 747
22330543  669 DDPDKPGTSEIRSPKPKKksKSkvKKRVRFVVPETPKIEKETRQELMELTEAREGGVAYIMGNAYMKAKPGSGLLKRLAI 748
224099721 669 DNIESAGTSELREIRSPPviQP--RKRVRFRVPDSPKINRGAREELQELVEAREAGIAYILGHSYVRAKQGSSMLKKLVI 746
224111286 669 DKIESAGTSELREIRSPPvmQP--RKRVRFIVPDSPKINRGAREELHELMEAREAGIAYILGHCYVRAKQGSSMLKKLVV 746
225452516 734 DLSDTVGTSELREIRSPE--RP--RKRVRFVLPDSPQIDRAAREELHELMEAREAGMAFILGHAYVRAKRGSSLIKRIVI 809
225424705 666 DNAQVAGTSELKEIQSPTvvRP--RKRVRFIVPESPKIDRGAREELQELMEAREAGIAYILGHSYVKAKPGSSMVKKLVI 743
255552638 658 DSSDMVGTSEVKEIQAPQ--RS--KKRVRFVVPESPQMDRDVRDELQELMEAREAGMAFILGHSYVRAKRGSSWMKKVVI 733
255587842 665 D--NIASTSELREIRSPPviHP--RKRVRFIIPESPKIDRVAREELHELMEAREAGVAYMLGHSYMRAKQGSSMIKKLVI 740
297807501 672 DKQEPSSSSEVIVVAPSP--RI--KKRVRFVLPESARIDRSAEEELTELTEAREAGMAFIMGHSYVRAKSGSSVMKKIAI 747
297841767 750 NIGYEFLRRNTRGPRNMLTSPNASTLEVGMIYHV 783
15241517  748 NFGYDFLRRNSRGPCYGLSTPHASTLEVGMVYIV 781
22330543  749 NIGYEFLRRNTRGPRNMLTSPHASTLEVGMIYNV 782
224099721 747 NYGYGFLRRNSRAPASTLSAPHASTLQVGMVYHV 780
224111286 747 NYGYEFLRRNSRAPAYALSVPHASTLEVGMVYRV 780
225452516 810 DIGYDFLRRNSRGPNYALSIPHASTLEVGMIYHV 843
225424705 744 NYGYDFLRRNSRGPSYALCVPHASTLEVGMNYLV 777
255552638 734 NYGYDFLRKNSRGPRYALSIPHASTLEVGMVYYV 767
255587842 741 NYGYEFLRRNSRASAYQLSVPHASTLEVGMIYNV 774
297807501 748 NFGYDFLRRNSRGPCYGLSTPHASTLEVGMVYIV 781
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap