Conserved Protein Domain Family
PLN00144

?
PLN00144: PLN00144 
acetylornithine transaminase
Statistics
?
PSSM-Id: 177748
View PSSM: PLN00144
Aligned: 20 rows
Threshold Bit Score: 692.983
Threshold Setting Gi: 145356827
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145356827   1 MVRGKGCALFDASGKEFLDFTSGIAVNCLGHADEGVARVIAEQARTLTHTSNLYHTEPGATLARKLTATSFADRVFFCNS 80 
168063956 105 FVSGKGCKLYDVEGNEYLDMTAGIAVNALGHGDPTWVKAVTEQAGKLAHVSNLFHTVPQVKLAERLVRSSFADRVFMVNS 184
167999458  24 FERGEGCKLYDTEGKEYLDLAAGIAVNSLGHGDPTWLKAINDQAANLAHVSNLYHTVPQVKLAERLVKWSFADRVFFTNS 103
159480034  76 ISHGKGAKMWDVEGKEYIDMAAGIAVNALGHSDSQWYAALVEQAEKLAHTSNLYHTQPQVELAKRLVENSFADKAFFCNT 155
255087426  72 FTHGLGCKMWDTEGKEYLDFCAGIAVNCLGHCDPDWVAAVTEQANKLCHVSNLYHTEPGATLARKLVDTCFADRVFYCNS 151
302780922  93 FVRGHGCKLYDIDGKEYLDMAAGIAVNSLGHGDPLWVKAILEQATTLAHVSNVYHSLPQVRLAERLVQSSFADRVFFSNS 172
302820150  93 FVRGHGCKLYDIDGKEYLDMAAGIAVNSLGHGDPLWVKAVLEQATTLAHVSNVYHSLPQVRLAERLVQSCFADRVFFSNS 172
302816149  93 FVRGHGCKLYDIDGKEYLDMAAGIAVNSLGHGDPLWVKAVLEQATTLAHVSNVYHSLPQVRLAERLVQSCFADRVFFSNS 172
302804793  93 FVRGHGCKLYDIDGKEYLDMAAGIAVNSLGHGDPLWVKAILEQATTLAHVSNVYHSLPQVRLAERLVQSSFADRVFFSNS 172
303281310  87 FTHGSGCVMWDSDGNRYLDFCAGIAVNVLGHSDPDWVEAVCEHAGKLCHVSNLYHTEPGATLARKLTDTCFADRVFYCNS 166
145356827  81 GTEANEGALKFARKYAKTRAQALGKNAGDa-------AWETVSFE--------------NGFHGRTFGALSLTWKEGYRA 139
168063956 185 GTEANEAAIKFARKYHYALAKSNGDTAQG--------ATELVAFT--------------NGFHGRTLGALSLTSKIQYRT 242
167999458 104 GTEANDAAIKFARKYQTVISNRKGDTRWIkfgk-lrpASELVSFS--------------SGFHGRTSGAQSHFSKLN--- 165
159480034 156 GTEANEGAIKFARKWARVRAGIDPYDGGAv------aPYELVSFT--------------SCFHGRTMGALALTYKEQYKT 215
255087426 152 GTEANEGAIKFARKVQMQRAKAADPDATQw-------ATETVSFS--------------NCFHGRTLGALNLTWKKQYRT 210
302780922 173 GTEANEAAIKFARKYQRVKAKEKSDKQASsplvedpiPTDFVAFS--------------NSFHGRTLGALALTSKEKYRA 238
302820150 173 GTEANEAAIKFARKYQRVKAKEKSDKQASpplvegpiATDFVAFS--------------NSFHGRTLGALALTSKDKYRA 238
302816149 173 GTEANEAAIKFARKYQRVKAKDMSDKQASpplveepiATDFVAFS--------------NSFHGRTLGALALTSKDKYRA 238
302804793 173 GTEANEAAIKFARKYQRVKAKEKSDKQASsplvedpiPTGFVAFS--------------NSFHGRTLGALALTSKEKYRA 238
303281310 167 GTEANEGAIKFARKYQMATAKAKDESATEw-------ATETVSFRrvlytgshttastiNCFHGRTLGSLNLTWKEAYRT 239
145356827 140 PFAPGLPGNTFTPYGDLEKARQVIvKGRTCAVFVEPVQGEGGIYPADAEFLRGLRAICDEADALLVYDEVQCGLGRTGKL 219
168063956 243 PFEPLVPGASFVNFGDLEATREIV-AGKTAAVFVEPLQGEGGICPATASFLRGLRELCDETGTLLVFDEIQCGLGRTGRL 321
167999458 166 -LEPLAPGAHCVEFGDLETTAKAIrRDRTAAVLVEPIQGEGGVHTASAEFLRGLRRLCDEAGALLIFDEVQCGLGRTGLL 244
159480034 216 PFYPMMPGHQLAEYNNLESAAAVIkKGKTAAVFVEPVQGEGGVTPSTQAFLKGLRQLCDEAGALLVFDEVQCGLGRTGKL 295
255087426 211 PFEPLSPGHSFATYGDLESAKKAIvKGKTAAVFVEPVQGEGGIFPADKAFLQGLKDICEEAGAVLIFDEVQCGLGRTGYL 290
302780922 239 PFEPIMPGVKFVEFGNLEAAKKIVqQQRTAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKL 318
302820150 239 PFEPIMPGVKFVEFGNLEAAKKIVqQQRTAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKL 318
302816149 239 PFEPIMPGVKFVEFGNLEAAKKIVqQQRTAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKL 318
302804793 239 PFEPIMPGVKFVEFGNLEAAEKIVqQQRTAAVFVEPVQGEGGVYPAIGHFLEGLRALCSSTGTLLVFDEVQCGLGRTGKL 318
303281310 240 PFAPLSPGHAFATYGDLDSARSAIvKGKTAAVFVEPVQGEGGIFPADGAFLSGLKEICDDAGALLVFDEVQCGLGRTGYL 319
145356827 220 WGHQLIkDAEPDMMSVAKPLANGLPIGAVLMKEKVAAVMAAGDHGSTFAGGPLVCAVANEVFDRVSDPAFLANVTERGNE 299
168063956 322 WAHETY-DVRPDIMTLAKPLAGGLPIGAVLVTDRVASSIAAGDHGSTFAGGPLVCHAALAVLDRIQAPGFLESVAEKGAY 400
167999458 245 WAHQAY-GVQPDMMTLAKPLAGGLPIGAVLVTEAVASTISAGDHGSTFAGGPLVCQAALSVLDRIQAPGFLEHVAAKGGH 323
159480034 296 WGHQLF-GVEPDMMTLAKPLAGGLPIGTVLLKQHVADVMKPGDHGSTFAGNPLVCHVACSVFDIINSPAFLAAVEAKGER 374
255087426 291 WGHQSV-DVTPDIMTVAKPLAGGLPIGAILCTQEVANAMAPGDHGSTFAGGPLVCNAANAVFDKVSDEDFLANVTARGEQ 369
302780922 319 WAHEAY-GIEPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDRLQEPGFLDSVANKGNH 397
302820150 319 WAHEAY-GIEPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDRLQEPGFLDSIAGKGNH 397
302816149 319 WAHEAY-GIEPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDCLQEPGFLDSVAGKGNH 397
302804793 319 WAHEAY-GIEPDIMTLAKPLAGGLPIGAVLVTQAVADAIVPGDHGSTFAGSPLVCSAALAVLDRLQEPGFLDSVASKGNH 397
303281310 320 WGHQSV-GVTPDIMTVAKPLAGGLPIGAVLTTQAVANAIAPGDHGSTFAGGPLVCGAANAVFDRVNSPGFMENVVKRGEQ 398
145356827 300 LKSSLTEKLAGHPRLREVRGAGLLVGVQFDCPTAPLVAACRARGLLTITAGKGDILRLVPPLIVSSAQVQKATDIVKECa 379
168063956 401 LKSQLNERLGKNSHVKEVRGEGLLVGIQLDVPASPLVASALKEKLLILTAGKGDVVRLAPPLIISKQEIDQAVDILVKC- 479
167999458 324 LRAQLREKIGTNPHVKEIRGVGLLIGVELDVPAAPLVEAALQAGLLILTAGNGYVVKLAPPLTISEAELNRAVDIIAGC- 402
159480034 375 LRAGLRRTMAGNPHVQEVRGVGLLVGVQLDMMAGPVVDAARDMGVMAITAGKGDVIRLVPPLVVTDAEIDTACEVLAAA- 453
255087426 370 LRSGLREALKDNGHVKEVRGSGLLVGVQLDCPAGPMVGECRKNGLLILTAGAGDVIRLLPPLVATEEEVDAAVGIIAKA- 448
302780922 398 LRDLLKRMLAPFPHVKEVRGAGLLVGIQLDVSAAPLVAAARSKGLIVLTAGAGDVVRLAPPLVISEAELEQCAEILVSC- 476
302820150 398 LRELLTRRLAPFAHVKEVRGAGLLVGIQLDVSAAPLVTAARSKGLIVLTAGAGDVVRLAPPLVISEAELEHCVEILVSC- 476
302816149 398 LRELLTRRLAPFAHVKEVRGAGLLVGIQLDVPAAPLVTAARSKGLIVLTAGAGDVVRLAPPLVISEAELEQCVEILVSC- 476
302804793 398 LRELLTRMLAPFPHVKEVRGAGLLVGIQLDVSAAPLVAAARSKGLIVLTAGAGDVVRLAPPLVISEAELEQCAEILVSC- 476
303281310 399 LRSGLRAKLEGCDRVKEVRGSGLLVGVQLDVPAGPLVGQARDRGLLLLTAGAGDVIRLLPPLVVSEEEVDIAVAIIADL- 477
145356827 380 FEALR 384
168063956 480 MPSLK 484
167999458 403 MSSLF 407
159480034 454 LNKVA 458
255087426 449 MSVLD 453
302780922 477 ISSLD 481
302820150 477 ISSLD 481
302816149 477 ISSLD 481
302804793 477 ISSLD 481
303281310 478 VKAL- 481
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap