Conserved Protein Domain Family
PLN00143

?
PLN00143: PLN00143 
tyrosine/nicotianamine aminotransferase; Provisional
Statistics
?
PSSM-Id: 165711
View PSSM: PLN00143
Aligned: 2 rows
Threshold Bit Score: 865.863
Threshold Setting Gi: 224092916
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224092914  11 EGIGNLKTPPPSySIKSVVKFLKENINEDDHRLAISLGVGDPSGFKCFRTTNIAEDAIVGAVRSAKFNSYAPTGGILSAR 90 
224092916   1 MGTNVLKTETPT-SIDDAVYFLKENFNEGDHRPAISFGFGDPSCFECFRTTPIAEDAIVEAVRSAKFNSYAPTGGILPAR 79 
224092914  91 RAIAEYLSNDLPYQLSPEDVYVTLGCKHAMEMIVKVLARPEANILLPRPGFRIYETYANSHHLELRHFDLLPQKGWEVDL 170
224092916  80 RAVADYLSRDLPYRLSPDDVYLTLGCNQAAEITIKVLARPGANILLPRPGYPDVETYAIFNNLEIRQFDLLPERGWEVDL 159
224092914 171 DAVEAIADENTIAMVIINPGNPCGSVYSYEHLSKIAETARKLGILVVADEVYGHIVFGSKPFVPMGVFGSTVPVITLGSI 250
224092916 160 DAVEAISDENTIAMVIINPGNPSGSVYTYNHLNKIAETARKLGILVIADEVYGHLVYGSSPFVPMSLFATIVPVITLGSV 239
224092914 251 SKRWMVPGWRLGWLVTSDPTGLLQICGIADSIKSALNPAPFSPTFIQAAVPEILEKTTEEFFSKTINILRAASAFCYDKL 330
224092916 240 SKRWMIPGWGLGWLVTCDPSGLLRKDEIAESINKLLVYSPFPPTLIQGSIPQILEKTTQDFFSKTINILRKNLDICYDKL 319
224092914 331 KEIPCITCPQRAEGAMFVLVKLNLSLLEDIEDDMEFCLKLAKEESLVILPGVTVGLKNWLRITFSVEQSSLEDGLGRLRS 410
224092916 320 KEIPCIMIPQKPEGAFFAMVKLNLLLLEDIEDDMEFCLKLAKEESLIILPGVTVGLKNWLRVTFAVEYSSLEDGLGRLKS 399
224092914 411 FCGRHAKKP 419
224092916 400 FCQRHAKKY 408
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap