Conserved Protein Domain Family
PLN00140

?
PLN00140: PLN00140 
alcohol acetyltransferase family protein; Provisional
Statistics
?
PSSM-Id: 165708
View PSSM: PLN00140
Aligned: 6 rows
Threshold Bit Score: 795.977
Threshold Setting Gi: 255577416
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224117256   1 MDVSIISRELIKPSSPSIHHL-SPFKLSLLDQLFPTTYVPMVFFYPTKNNQDFKGLQISIQLKRSLSQTLSTFYPLSGRV 79 
224105367   1 MDVSIISRELIKPSSPSIHHL-LPFKLSLLDQLLPTTYVPMVFFYPRNNNQDFKGLQISIQLKRSLSQTLSTFYPFSGRV 79 
224105371   1 MDVSIISRELIKPSSPSIHHL-LPFKLSLLDQLLPTTYVPMVFFYPRNNNQDFKGLQISIQLKRSLSQTLSTFYPFSGRV 79 
255577416   1 MEVHIVSREMMKPSSPAIKHQ-KPYKLCLLDQLTPTTYIPIIFFYPMNN---LFTKSTLAHLKESLVKTLNFYYPFSGRA 76 
255585363   5 MQVDIISREVIKPSSPTIHHY-KPFKFPLFSQLTPTTYSPVIFFYPTTK-PNLNITQTLIHLKKTLAETLTLYYPFSGRV 82 
255587870   1 MESLFISKEIIKPSSSHAIHLpKPFRLSFLDQIIPTTYIPLIFFYSANDNNNFKKFQISTQLKISLSENLSTFYPFSGRV 80 
224117256  80 RNNSLIDNYEKGAPFVETRVKG-SLFDFLIQPQLNSL-NKFLPCQPLGYQSDPEATPQVAIQVNTFDCGGTALGLCFSHK 157
224105367  80 RNNSIIDNYEKGAPFVETRVKG-SLFDFLIQPQLNLL-NKFLPCQPFGYQSDPEATPQVAIQVNTFDCGGTALGLCFSHK 157
224105371  80 RNNSIIDNYEKGAPFVETRVKG-SLFDFLIQPQLNLL-NKFLPCQPFGYQSDPEATPQVAIQVNTFDCGGTALGLCFSHK 157
255577416  77 KDNLYIDRFEEGVPFFEAKVNC-SMSYFLKHYETESLsNLFIPSHPFSKEID-MSIALVAVQVSMFTCGGIAVGLCLSHK 154
255585363  83 VDNLSIDHFDEGVPFFIARVTGlVLSDFLKNPEIELL-NGFLPYKPFTKETD-KGVPQMAFQVNVFSCGGIVIGWSSSHK 160
255587870  81 KDNLFIDNYEEGVPFIETRVKS-HLTDFLEHPQVEFL-NQFLPCQPFSYLRDPETIAPIAIQLNFFDCGGIALGVCMSHK 158
224117256 158 IIDVATAIAFLDSWAANTR-GHYHEQKNPALFEASSRFPPLNKFLVQVPLWVAENCLFKEGN--VTKRFVFDADAVATLR 234
224105367 158 IIDVATAIAFLDSWAANTR-GHYLEQINPALFEASSRFPPQNKFLVQFPLWVAENYLFKEGN--VTKRFVFDADAIATLR 234
224105371 158 IIDVATAIAFLDSWAANTR-GHYLEQINPALFEASSRFPPQNKFLVQFPLWVAENYLFKEGN--VTKRFVFDADAIATLR 234
255577416 155 LIDAATASSFVTTWASFCR-GDPKNVIQPDFEQPSTFFPSSTSLPQNYLSLMERIWFVKANY--ITKRFVFDAKAIAALR 231
255585363 161 LVDGPTGAAFIHAWATMSRtGSLSDVIKPNCDEASIFFPPRNPFPEEHLSLMESLWFTKGNY--ISKRFVFDSKAIASLR 238
255587870 159 ITDATTMSAFLNNWANNLR-GFSSKKIIPDLSVASSCFPPLESPSSQTYLALMEKLWSSDEHkdITKRFVFDANAILNLK 237
224117256 235 ARAK---SKRVPNPSRTETLTAFIWKSCTEACRSLRALPRPSVSLHAVNIRQRTEPSFSRYSIGNLWWRSMTACELADTK 311
224105367 235 AKAK---SKRVPNPSRTETLTAFIWKSCTEACRSLCALPRPSVSLHAVNIRQRTKPSFSRYSIGNLWWRSLTACELADTK 311
224105371 235 AKAK---SKRVPNPSRTETLTAFIWKSCTEACRSLCALPRPSVSLHAVNIRQRTKPSFSRYSIGNLWWRSLTACELADTK 311
255577416 232 VKAK---AKLEAEPTRIATLSCFIWKCSMAASRAISGAPKPSILVEAVNLRQKTKPPMKDSSTGNLFWWAVALASPTDTN 308
255585363 239 VKARgegNEKKNMPSRVEALSCFIWKCCMAASRAASGTPKPSILVEAVNLRTRTKPPMSKVSIGDIFWWATAVADPSLHN 318
255587870 238 AQAK---SESVDNPTRIKAISSFIWKCCTTASRSISAASRPSLSVHTVNIRQRTKPCLSVYTVGNIFWWAIAATDVADTK 314
224117256 312 -IELNDLVSLTRESFANINDDRLKDFQGENGFQGITVsLLKQLVGIVS-RNPEIFMFSSWLNFDLNDVDFGWGKPIWVGL 389
224105367 312 -IELNDLVSLTRESFTNINDDLLKDFQGENGLQGISEsLLKQLVGIGS-RNPEIFLFSSWLNFDLNDVDFGWGKPIWVGL 389
224105371 312 -IELNDLVSLTRESFTNINDDLLKDFQGENGLQGISEsLLKQLVGIGS-RNPEIFLFSSWLNFDLNDVDFGWGKPIWVGL 389
255577416 309 sTELNELVSMLSEAIAVYKSDYTHSLQGENGLKIMSE-YCEQLEGMFSlEEPDIFGFTSWSKMPVTRPNFGWGEPFWVGL 387
255585363 319 -KELHELATLLDEAIALYDSDYMESLQGEDGFETMSE-YCNQLRGLFSiEEPDIFAFTSWSRLGIYDMDFGFGNPFWIGI 396
255587870 315 -MGLENFAALTNESIEKLNHHYVNTLQGERGPEAASE-FLNQLVEIVS-EKPEIFSFSSWLNFGFNELDFGWGKPIWVGL 391
224117256 390 TGEVGrpSGFANITFFKQTGRNNEIEAWMTLNEKIMSAVERNPEFLEFSTPNPSIFMP 447
224105367 390 TGEVGrpSGWANATFFKQTGRNNEIEVWMTLNEKIMSVVERNPEFLEFSTPNPSIFMP 447
224105371 390 TGEVGrpSGWANATFFKQTGRNNEIEVWMTLNEKIMSVVERNPEFLEFSTPNPSIFMP 447
255577416 388 MAKAG--PEFRNFTVFIDTKDGKGIEAWITLDEARMAILQRDPEFLAFASPNPKISSL 443
255585363 397 LGKVG--PAFRNLTVFLETRDGKGIEAWITLDEERMALLERDPEFLANASPNPRFSSL 452
255587870 392 LGELG--PAFRNLVIFKESMCNNGIEAWVTLDKNIMDILEEDPEFLKFATPNPGILMP 447
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap