Conserved Protein Domain Family
PLN00139

?
PLN00139: PLN00139 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165707
View PSSM: PLN00139
Aligned: 6 rows
Threshold Bit Score: 659.327
Threshold Setting Gi: 242081351
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242081351   1 MAATDFFCVNECKGQKTIDGEQVPLVLAPSGggDAKsNGYEALVEAVKANREWVEAKVVANSGLLLRGFDVRDAAEFNAV 80 
224146078   2 EISYKDFKVGKCEGQKVVDGETMPLVLQPPE--PNK-SDTESLISALKQNKDWFEQMLIKNSAVLLRGFDVKNAEDFNDI 78 
225423851   2 EFSCEEFKVGKCEGQKLVHGETMPLVLHSPD--PNNsSDLDSLVSSLKKNKDWFEQMIIKNSAVLLRGYDVKNAEDFNQI 79 
224143714   2 EISYKDFKVGKCEGQKVVDGETMPLVLQPPE--PNK-SDTESLISALKQNKDWFEQMLIKNSAVLLRGFDVKNAEDFNDI 78 
224108559   2 EISYKDFKVGKCEGQKVVDGETMPLVLQPPE--PNK-SDTESLISALKQNKDWFEQMLIKNSAVLLRGFDVKNAEDFNDI 78 
255566815   2 EFSCKYFKVGKCEGEKVVDGETMPLVLQPSE--PDK-NGLESLVLALKTNKDWFEQMIIKNSAVLLRGFDVKKAEDFNDI 78 
242081351  81 VEALGWPDIRYVGPAPRTHVHGRVWTANEGPLEEFIYYHHEMVLIKEFPGKVILFCEVPPPSGGETPFVPSFRVTERALE 160
224146078  79 IEAFGWDDIRYIGPAPRTQVYKRIWTANEGPLSEFIYYHHEMVLIKESPKKVMFFCEIPPPEGGQTPFVPSFRVTERMLE 158
225423851  80 VEAFGWDDIRYVGPAPRTHVYKRIWTANEGPLEEFIYYHHEMVLIKEYPKKVILFCEVPPPKGGETPFVPSFRVTERMLE 159
224143714  79 IEAFGWDDIRYIGPAPRTQVYKRIWTANEGPLSEFIYYHHEMVLIKESPKKVMFFCEIPPPEGGQTPFVPSFRVTERMLE 158
224108559  79 IEAFGWDDIRYIGPAPRTQVYKRIWTANEGPLSEFIYYHHEMVLIKESPKKVVLFCEIPPPEGGQTPFVPSFRVTERMLE 158
255566815  79 IEAFDWDDIRYVGPAPRTHIYKRVWTANEGPLSEFIYYHHEMVLIKESPLKVVLFCEIPPPEGGQTPFVPSFKVTERMLE 158
242081351 161 EFPELVEKLDEQGLRYTFTALSKNDTKSMRGRGWEDAFATSDRGEAEKRARALGMDVEWLPDGGVRTILGPRKLTRVFPG 240
224146078 159 EFPEAVEEVEAKGLKYTFTAPSKDDTSSMRGRGWEHAFGTSDKAEAERRAKAIGMDMEWLPNGGVKTIMGPPSLTKVFDG 238
225423851 160 EFPGAVEDIDSKGLKYTFTALSKNDTSSMRGRGWEDTFGTSDRAEAEKRAKALGMDMEWLPNGGVKTVLGPRALTKVFDG 239
224143714 159 EFPEAVEEVEAKGLKYTFTAPSKDDTSSMRGRGWEHAFGTSDKAEAERRAKAIGMDMEWLPNGGVKTIMGPPSLTKVFDG 238
224108559 159 EFPEAVEEVEAKGLKYTFTALSKDDTSSMRGRGWEDAFGTSDKAEAERRAKALGMDMEWLPNGGVKTILGPRSLTKVFDG 238
255566815 159 EFPKEVEEMEAKGLKYTFSAPSNNNTGSMRGRGWEDAFGTSDPAEAERRAKALGMDMEWMADGGVKTRLGPRPLTRVFDG 238
242081351 241 RKGRRMWFNTVVGMHGKELSSATLADGSEIPADFVRRCGEIIEEESIQFRWEKGDILILDNLATLHGRRPSLPPRRVLVA 320
224146078 239 RKGRRMWFNTVVGMHGKESSSAMLADGTEIPENFVKRCGQIIEEESIQFKWEKGDVLFLDNMALLHGRRPSLPPRKVLVA 318
225423851 240 RKGRRMWFNTMVGMHGKEHSSAMMADGTEIPANVVKRCEEIIEEESIQFKWEKGDVLVLDNLALLHGRRPSLPPRRVLVT 319
224143714 239 RKGRRMWFNTVVGMHGKESSSAMLADGTEIPENFVKRCGQIIEEESIQFKWEKGDVLFLDNMALLHGRRPSLPPRKVLVA 318
224108559 239 RKGRRMWFNTVVGMHGKESSSAMLADGTEIPENFVKRCGQIIEEESIQFKWEKGDVLFLDNMALLHGRRPSLPPRKVLVA 318
255566815 239 RKGRRMWFNTVVGMHGKELSSATMADGTEIPEHVVKRCEQIIEEESIQFKWETGDVLFLDNLALLHGRRPSLPPRKVLVA 318
242081351 321 TCK 323
224146078 319 ICK 321
225423851 320 TCK 322
224143714 319 ICK 321
224108559 319 TCK 321
255566815 319 TCK 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap