Conserved Protein Domain Family
PLN00138

?
PLN00138: PLN00138 
large subunit ribosomal protein LP2; Provisional
Statistics
?
PSSM-Id: 165706
View PSSM: PLN00138
Aligned: 6 rows
Threshold Bit Score: 134.03
Threshold Setting Gi: 255576341
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224131600   1 MKVVAAYLLAVLGGNTCPTAEDLKHILGSVGADADDDRIELLLSSVKGKDITELIASGREKLASVPSGGGVAVAAGGAPA 80 
224105037   1 MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGKDITELIASGREKLASVPSGGGVAVSAGAAPA 80 
225440938   1 MKVIAAYLLAVLGGNTCPSANDLKDILGSVGAEADDDRIELLLSEVKGKDITELIASGREKLASVPSGGGVAVAATAVGG 80 
225436297   4 MKVIAAYLLAVLGGNTCPSAEDLKDILGSVGAEADDDRIELLLAEVKGKDITELIASGREKLASVPSGGGAAVAVAAPGG 83 
225436299   1 MKVIAAYLLAVLGGNTCPSAEDLKDILGSVGAEADDDRIELLLAEVKGKDITELIASGREKLASVPSGGGAAVAVAAPGG 80 
255576341   1 MKIVAAYLLAVLGGNTSPSAEDLKEILGSVGIDADEDRIGLLLSQVKGKDITELIAAGREKLASVPSGGGVAVAAAAAPA 80 
224131600  81 AAsGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD 114
224105037  81 AA-GGAAPAAEAKKEEKVEEKEESDDDMGFSLFD 113
225440938  81 ASgGGAPAAPEPKKEEKVEEKEESDDDMGFSLFD 114
225436297  84 GG-AAAPAAAEPKKEEKVEEKEESDDDMGFSLFD 116
225436299  81 GG-AAAPAAAEPKKEEKVEEKEESDDDMGFSLFD 113
255576341  81 AG-GAAAPAAEAKKEEKVEEKEESDDDMGFSLFD 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap