Conserved Protein Domain Family
PLN00135

?
PLN00135: PLN00135 
malate dehydrogenase
Statistics
?
PSSM-Id: 177744
View PSSM: PLN00135
Aligned: 25 rows
Threshold Bit Score: 537.434
Threshold Setting Gi: 145347345
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242073934   1 MIARGLMLGPDQPVVLHMLDLPKSAETLNGVRMELIDAALPLLRGVVATSDEAEAFRGVNFAVLIGGSPRREGMQRKDLI 80 
115459790  45 MIARGLMLGADQPVVLHLLDLPVAANALNGVRMELIDAALPLLRGVVATSDEAEAFKGVNVAIVIGGWPRRDGMERKDLI 124
15241923   30 MIARGIMLGPDQPMILHLLDIEPASSSLEAVKMELQDSAFPLLKGVIATTNVVEACKDVNIVIMIGGFPRIAGMERKDVM 109
145347345  28 MVCAGAATGPGKKIALKLLDVEFASEALRGVKMEIMDCAFDACVSVDVFTDCEKACEGVDVAIMVGGFPRKQGMERKDVL 107
225453490  24 MIARGLMLGPDQPVILHMLDIEPAAEALNGVKMELIDAAFPLLRGVVATTDAIEACKDVNIAVMVGGFPRKEGMERKDMM 103
224063661  24 MIARGVMLGPDQPVILHLLDIEPAAEALNGVKMELIDAAFPLLKGVIATTDPIEACMGVNIAVMVGGFPRKEGMERKDVM 103
224063665  24 MIARGIMLGPDQPVILHLLDIQPVAESLKGVRMELIDAAFPLLQGILATTDVNEACKGVNIAVMVGGFPCKEGMERRDVM 103
255541140  24 MIARGVMLGPDQPVILHLLDIEPASEALKGVKMELIDAAFPLLKGVIATTDAVEACMGVNIAVMVGGFPRKEGMERKDVM 103
297793183  30 MIARGMMLGPDQPMILHLLDIEPASSSLEAVKMELQDSAFPLLKGVIATTDVVEACKDVNIAIMIGGFPRIAGMERKDVM 109
302813280  24 MIARGVMLGPDQPVILHMLDIPPAAESLNGVKMELIDSAFPLLKGVIATTDVEEACKDVNIAVMVGGFPRKEGMERKDVM 103
242073934  81 AKNVPIYQSQASALQQHAAPNCKVLVVANPANTNALVLKEFAPAVPAKNITCLTRLDHNRALGQISEKLGVHVADVRNAI 160
115459790 125 SKNVTIYKSQASALHQHAAPNCKVLVVANPANTNALVLKEFAPAIPAKNITCLTRLDHNRALGQVAEKLNVHVGDVKNAI 204
15241923  110 SKNVVIYKAQASALERYASDDCKVLVVANPANTNALILKEFAPSIPEENITCLTRLDHNRALAQLADKLSVPVSSVKNVI 189
145347345 108 GKNVAIYKQQASALASKAKKDVKIVVVANPANTNAKILAKFAPSIPRGNVTCMTRLDHNRALAQLGERSGKATIEVKNAI 187
225453490 104 KKNVSIYKAQASALEQHAAPNCKVLVVANPANTNALILKEFAPSIPEKNVTCLTRLDHNRALGQISEKLFVHVGDVKNAI 183
224063661 104 SKNVSIYKAQASALEKHAAEDCKVLVIANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISESLDVQVSDVKNVI 183
224063665 104 HKNVPIFKAQASALEQHAAPDCKILVVANPANTNALILKEFAPSIPVKNITCLTRLDHNRALSHISERLNVDVRDVKNVI 183
255541140 104 SKNVSIYKAQASALEKHAAADCKVLVVANPANTNALILKEFAPSIPEKNITCLTRLDHNRALGQISERLDVHVSEVTNVI 183
297793183 110 SKNVVIYKAQASALERYASEDCKVLVVANPANTNALILKEFAPSIPEENITCLTRLDHNRALAQLADKLSVPVSSVKNVI 189
302813280 104 SKNVSIYKSQASALEKCAAKDVKVLVVANPANTNALILKEFAPSIPDKNITCLTRLDHNRALGQISERTGFQVSDVKNVI 183
242073934 161 VWGNHSSTQFPDARHATARTQHGEKPVVELVADEKWLKEEFVSVVQQRGEAVIKARKQSSSLSAASAACDHMRDWILGTP 240
115459790 205 IWGNHSSTQFPDASHATVSTDRGERPVRELIADEIWLREEFVTDVQQRGAAVIKARKQSSSLSAASAACDHMRDWILGTP 284
15241923  190 VWGNHSSTQYPDTNHATVSTKTGDRPLKELVTDHNWLKNEFIVEVQQRGAAVLRARKQSSAFSAAGAACDHIRDWFLGTP 269
145347345 188 IWGNHSSTQYPDVNHATI----EGKPAREVIGNDAYLDGDFVDVVRARGAAIIEARKLSSALSAASSVCDHVYDWIHGTK 263
225453490 184 IWGNHSSTQYPDVNHATVSTCNGEKPVRELIADDNWINTEFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTP 263
224063661 184 IWGNHSSTQYPDVNHATVQTSSGEKPVRELVSDDKWLNAEFITTVQQRGAAVIKARKLSSALSAASAACDHIRDWVLGTP 263
224063665 184 IWGNHSSTQYPDANYAIATTDIGEKSVRELVADDHWIDYEYINSVRERGAEIIKARKLSSALSAASAACDHVHDWIIGTA 263
255541140 184 IWGNHSSTQYPDVNHATVQTSSGEKPVRELVADDQWLNAEFITTVQQRGAAIIKARKLSSALSAASAACDHIRDWVLGTP 263
297793183 190 IWGNHSSTQYPDTNHATVSTKSGDRPVKELVTDHNWLKSEFITEVQQRGAAILRARKQSSALSAASAACDHIRDWFLGSP 269
302813280 184 IWGNHSSTQYPDVNHAVVITPKGEKPVREVVNDDEWLNGPFITTVQQRGAAIIKARKLSSALSAASSACDHIRDWVLGTP 263
242073934 241 KechfglqGTWVSMGVYSDGSYGVPEGIFYSFPVTCDKGEWSIVQGLEVDDFARSKMELSANELDEERSMAYEFVS 316
115459790 285 K-------GTWVSMGVYSDGSYGVPEGVFFSFPVTCEKGEWSVVQGLEIDDFARSKMETSATELKEEKSIAYEFL- 352
15241923  270 K-------GTWVSMGVCSDGSYGIPPGLVYSFPVICEKGSWKIVQGLSIDEFSREKMDDSARELAEEKDLAYSCLN 338
145347345 264 E-------GEWTSMGVISDGSYGVPEGLVYSFPVTCTGGKWQIVQGLSIDERSRKLMDESAKELTEEFELAEQCLA 332
225453490 264 K-------GAWVSMGVYSDGSYGIQPGIIYSFPVTCEKGEWSIVQGLKIDEFSRGKMDATAKELMEEKALAYSCLN 332
224063661 264 E-------GTWVSMGVYSDGSYGIQPGLVYSFPVTCEKGKWSIVQGLKIDDFSRAKMDATAKELVEEKSLAYSCLN 332
224063665 264 K-------GTWVSMGVYSDGSYGIQPDIIYSFPVTCQKGEWSIVQGLKINEFSREKMDTSMKELTREESLAYSCLN 332
255541140 264 K-------GTWVSMGVYSDGSYGIQPGLIYSFPVTCEKGNWSIVQGLKIDEFSRAKMDATAKELIEEKSLAYSCLN 332
297793183 270 K-------GTWVSMGVCSDGSYGIPPDLVYSFPVICEKGSWKIVQGLNIDAFSREKMDDSARELAEEKELAYSCLN 338
302813280 264 K-------GTWVSMGVLSDGSYKVPKGVIYSFPVTCANGEWSIVQGLLIDGFSRTKLDATADELIEEKEMAYSCL- 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap