Conserved Protein Domain Family
PLN00131

?
PLN00131: PLN00131 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165700
View PSSM: PLN00131
Aligned: 3 rows
Threshold Bit Score: 452.957
Threshold Setting Gi: 224144269
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224144269   1 MHILRPLSPHLPIYKPQLTSAFPIFRRCFFFFMRKGGIVSLILVYMTPLLFNWGLTWGAPFFIFFAEWIDFLLSSMEGFP 80 
224112058   1 MHILRPLSPHLPIYKPQLTSAFPIFRRCFFFFMRKGGIVSLILVYMTPLLFNWGLTWGAPFFIFFAEWIDFLLSSMEGFP 80 
224109094   1 MHILRPLSPHLPIYKPQLTSAFPIFRRCFFFFMRKGGIVSLILVYMTPLLFNWGLTWGAPFFIFFAEWIDFLLSSMEGFP 80 
224144269  81 LSIGGGGSDAGPSRRPVLDLNSTPQPELDLNQPAAHEQEPEPAPPLDDQDLLTKRKRVSEELRLLLQIGAVKRKNKIADQ 160
224112058  81 LSIGGGGSDAGPSRRPVLDLNSTPQPELDLNQPAAHEQEPEPAPPLDDQDLLTKRKRVSEELRLLLQIGAVKRKNKIADQ 160
224109094  81 LSIGGGGSDAGPSRRPVLDLNSTPQPELDLNQPAAHEQEPEPAPPLDDQDLLTKRKRVSEELRLLLQIGAVKRKNKIADQ 160
224144269 161 LLDWMGLDNETDRTLLDDLYNHLYDLSEEQGRRVGQPQMFSSKGIKSLKLWFLNRKER 218
224112058 161 LLDWMGLDNETDRTLLDDLYNHLYDLSEEQGRRVGQPQMFSSKGIKSLKLWFLNRKER 218
224109094 161 LLDWMGLDNETDRTLLDDLYNHLYDLSEEQGRRVGQPQMFSSKGIKSLKLWFLNRKER 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap