Conserved Protein Domain Family
PLN00130

?
PLN00130: PLN00130 
succinate dehydrogenase (SDH3); Provisional
Statistics
?
PSSM-Id: 177741
View PSSM: PLN00130
Aligned: 3 rows
Threshold Bit Score: 392.201
Threshold Setting Gi: 186515438
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
186515438   1 MAATALFRSIRRRDVVSAPLSVYKSLAGNAQPSWGSSYIGQNYASFSRAFGSKPVVNDILGTGLGTNNAIREEREKSKST 80 
15242460    1 MAATALFRSIRRRDVVSAPLSVYKSLAGNAQPSWGSSYIGQNYASFSRAFGSKPVVNDILGTGLGTNNAIREEREKSKST 80 
297806993   1 MAATALFRSIRRRDVVSAPLSVYKSLAGNAQPSWGSSYTGQNYASLCRAFGSKPVVNDILGTGLGTNNAIREEREHSKAN 80 
186515438  81 EAAIVGAQLTRSFRALDVGTSKRLFSTISGDIKTTQEEPKIKSFRPLSPHLSVYQPQMNSMLSIFNRISGVYLTGVTFAG 160
15242460   81 EAAIVGAQLTRSFRALDVGTSKRLFSTISGDIKTTQEEPKIKSFRPLSPHLSVYQPQMNSMLSIFNRISGVYLTGVTFAG 160
297806993  81 ETATVGAQLTRSFRTLDVGTSKRLFSTISGDIKTTQEEPKTKSFRPLSPHLTVYQPQMNSMLSIFNRISGVYLTGVTFAG 160
186515438 161 YLLYLKMGMICLTYPSFYQVLYHTQQQLPVITSVTALAAIYHTIKSTHSLLTH 213
15242460  161 YLLYLKMGMICLTYPSFYQVLYHTQQQLPVITSVTALAAIYHTIKSTHSLLTH 213
297806993 161 YLLYLKMGMICLTYPSFYQVLYHTQQQLPVITSVTALAAIYHTIKSTHSLLTH 213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap