Conserved Protein Domain Family
PLN00128

?
PLN00128: PLN00128 
Succinate dehydrogenase [ubiquinone] flavoprotein subunit
Statistics
?
PSSM-Id: 177739
View PSSM: PLN00128
Aligned: 21 rows
Threshold Bit Score: 1233.19
Threshold Setting Gi: 224010078
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219113829   3 KTRRKPTTKIRDLHRRVAVTSVGSKSLSTSPHLI---------------GDYTVIDHTYDAVVVGAGGSGLRAAMGLSEA 67 
168056666   1 MLRRVVESSTKRLLRQRNGALARSRSQQPKRGFAvd------------aKSYPIVDHTYDAIVVGAGGAGLRAAIGLSET 68 
168019279   1 ------------------------------------------------mQSYPLVDHTYDAIVVGAGGAGLRAAIGLSES 32 
159463224   1 --MPVLAKLLGGASKASSLQQLAGLGQRAALAATqqag--------fasQSYPVIDHQYDAIVVGAGGAGLRAAVGLSEL 70 
145356472   4 CERGCVAARNALTTSASGSGSGSGSGRSIATAASss------------tSSYEIIDHEYDALVVGAGGAGLRAAIGLGEH 71 
255087886   1 ---MSLRRKIIGAAARWAGSSAAPQWARQAVCGFhstgaasaaagapgkSAYTIIDHEYDAVVVGAGGAGLRAAIGLSEH 77 
303289252   2 SARKILGAAARAVGARMGGAPAPSTWTRPAACGFatsas-----agankPAYQIIDHEYDAVVVGAGGAGLRAAIGLSEH 76 
302806996   4 LARAALREQRQRRLYSSASRVLSNAAPSTTG------------------AAYPIVDHTYDAVVVGAGGAGLRAAIGLSEH 65 
302836143   1 --MSVLAKLLTGTAAKAQSTQLGLLGQRSILATAqqtalpe--lrgyasQTYPVIDHQYDAVVVGAGGAGLRAAVGLSEL 76 
302773241   4 LARAALREQHQRRLYSSASRVLSNGAPSATG------------------AAYPIVDHTYDAVVVGAGGAGLRAAIGLSEH 65 
219113829  68 GFKTACVTKLFPTRSHTVAAQGGINAALGNMGEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVLELEEFGMPFSRT 147
168056666  69 GFTTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT 148
168019279  33 GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT 112
159463224  71 GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRT 150
145356472  72 GFKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGADWLGDQDAIQYMCREAPKAVIELEKYGMPFSRT 151
255087886  78 GLKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRT 157
303289252  77 GLKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGADWLGDQDAIQYMCREAPKAVIELENYGLPFSRT 156
302806996  66 GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPAAVIELENYGLPFSRT 145
302836143  77 GFKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAIHYMCREAPKAVIELENYGLPFSRT 156
302773241  66 GFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPAAVIELENYGLPFSRT 145
219113829 148 EEGKIYQRAFGGQSLDFGKGGQAYRCAAAADRTGHAMLHTLYGRSLAFDTTYFIEYFAMDLLMNDQGECVGVVALNMEDG 227
168056666 149 EDGKIYQRAFGGQSLNFGKGGQAYRCAAAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDEQGACRGVIALNMEDG 228
168019279 113 EEGKIYQRAFGGQSLNFGKGGQAYRCAAAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDDEGACRGVTALNMEDG 192
159463224 151 EDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHDIQFYVEYFALDLIMDSDGVCRGVMALCMEDG 230
145356472 152 DEGKIYQRAFGGQSLDYGKGGQAYRCAAAADRTGHAMLHTLYGAALKHDVQFFVEYFALDLIMD-KGECVGIMALCLEDG 230
255087886 158 DDGKIYQRAFGGQSLDYGKGGQAYRCACAADRTGHAMLHTLYGQALKHDTQFFVEYFALDLIMH-EGECVGVVAMCMEDG 236
303289252 157 DDEKIYQRAFGGQSLDYGRGGQAYRCACAADRTGHAMLHTLYGQALKHDTQFFVEYFALDLIMD-RGECVGVVAMCMEDG 235
302806996 146 EEGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMDDEGACRGVMALNMEDG 225
302836143 157 EDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGMAMKHNIQFFVEYFALDLMMDSDGACRGIMALCMEDG 236
302773241 146 EEGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLIMDDEGACRGVMALNMEDG 225
219113829 228 TIHRIHAKNTVLATGGYGRTYFSCTSAHTCTGDGNAMAMRQGLSNQDNEFVQFHPTGIYGAGCLITEGCRGEGGILRNSE 307
168056666 229 TLHRFRAMNTILATGGYGRAYFSATSAHTCTGDGNAMAARAGIPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 308
168019279 193 TLHRFRAANTILATGGYGRAYFSATSAHTCTGDGNAMAARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 272
159463224 231 TLHRFQAHQTVLATGGYGRAYFSATSAHTCTGDGNAMAARAGIPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 310
145356472 231 TLHRFRSHQTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDQEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 310
255087886 237 TIHRFRSHKTVLATGGYGRAYFSATSAHTCTGDGNAMVTRAGLPMQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 316
303289252 236 TIHRFRSHKTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 315
302806996 226 TLHRFRALSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 305
302836143 237 TIHRFQAHQTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGCRGEGGILRNSE 316
302773241 226 TLHRFRALSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSE 305
219113829 308 GERFMERYAPSAKDLASRDVVSRSMTMEIREGRGAGPKKDHIYLHLDHLPPDLLAERLPGISETAAIFAGVDVTKEPIPV 387
168056666 309 GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPV 388
168019279 273 GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPV 352
159463224 311 GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGCGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPV 390
145356472 311 GERFMERYAPSAKDLASRDVVSRSMTLEIREGRGVGKEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPV 390
255087886 317 GERFMERYAPSAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPV 396
303289252 316 GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPEILAERLPGISETAAIFAGVDVTKEPIPV 395
302806996 306 GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPV 385
302836143 317 GERFMERYAPTAKDLASRDVVSRSMTIEIREGRGCGPEKDHIYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPV 396
302773241 306 GERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPV 385
219113829 388 LPTVHYNMGGIPTNHYGEVIRTKFDkdgnfSKDEVVPGLFASGESACASVHGANRLGANSLLDIVVFGRACANRIAEIAK 467
168056666 389 LPTVHYNMGGIPTNYHGEVLTKKGD-----DPDCMIPGLMAAGEAACASVHGANRLGANSLLDIVIFGRACANRVAEMFK 463
168019279 353 LPTVHYNMGGIPTNHHGEVVTKKGN-----DPDCMIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEKFK 427
159463224 391 LPTVHYNMGGVPTNYMGEVLAPTPD-----NPDKVVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRIGQIMK 465
145356472 391 IPTVHYNMGGIPTNYKGEVVAPKNG-----DPDAIVPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANTVADKLK 465
255087886 397 IPTVHYNMGGIPTNYKGEVLTLGSD-----GKDTVVPGLLAAGECASSSVHGANRLGANSLLDIVVFGRACANTIAETLK 471
303289252 396 IPTVHYNMGGIPTNYKGEVLTIGSDg----NPDTVVPGLLAAGECASASVHGANRLGANSLLDIVVFGRACANTVSETLK 471
302806996 386 LPTVHYNMGGIPTNYRGEGVTTKDG-----DPDCLIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANTMAEIYK 460
302836143 397 LPTVHYNMGGIPTNYMGEVLAPTKE-----NPDKVVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRVGEIMK 471
302773241 386 LPTVHYNMGGIPTNYRGEGVTTKDG-----DPDCLIPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANTMAEIYK 460
219113829 468 PGDKIADGPSDVGFGSIAELDKLRYAEGHATTADIRSEMQSVMQEHAAVYRTTQTLAEGKTAIDGVVDKFKDIAVTDKSL 547
168056666 464 PGQKQPELPKDAGEKTIAWLDKLRYANGDIPTANIRNKMQRVMQNNAAVFRTQETLEEGCKLIDETVDSLSRVKTNDRSL 543
168019279 428 PGQSQPELPKDAGEKTIAWLDKLRYANGDLPTSEIRNRMQRTMQNNAAVFRTQETLEEGCKLIDETVDSFSRVKINDRSL 507
159463224 466 PNTPHKPLPATAGEGAVARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQESLEEGCKLIDETMASFQDVKTTDRGL 545
145356472 466 RGAPHREIASDAGSNAIERLDKIRNSKGSAPTAMLRKTMQKVMQEDAAVFRTQETLANGCKRIDDVAAQLDNLKLTDRSL 545
255087886 472 PGTPHKKIPSDAGENAVAHLDKVRWSNGQHSTADVRKTMQRVMQDDAAVFRTQETLAEGVKKIDEVAARLDDLKVTDKSM 551
303289252 472 PGMPHRKLASDFGEHAIAHLESVRSASGAHSTASVRKAMQRVMQDDAAVFRTQETLAEGCVKIDEVASRLEDLDVTDKSL 551
302806996 461 PGDKQKPLPKNAGEGTIAWLNKLRYANGDIPTASIRLSMQRVMQNNAAVFRTQETLEEGCKLINEIWDSFSRVKTSDRSL 540
302836143 472 PNTPHKPLPASAGEHAIARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQETLAEGCKLIDECAASFSDVKVTDRGL 551
302773241 461 PGDKQKPLPKNAGEGTIAWLNKLRYANGDLPTASIRLSMQRVMQNNAAVFRTQETLEEGCKLINEIWDSFSRVKTSDRSL 540
219113829 548 VWNTDLVETLELRNLLACASTTMYGAENRKESRGAHAHEDYPTRDDENWMKHTLSYFDEstGRTEIKYRPIHYYTLDeDE 627
168056666 544 TWNTDLIETIELENLLINASVTMHSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWEN--DRVRLDYRPVHMNTLD-DE 620
168019279 508 TWNTDLIETIELENLLINASITMHSAEARKESRGAHAREDFSVRDDEKWMKHTLGFWDE--NRVKLDYRPVHMNTLD-DE 584
159463224 546 VWNTDLIETLELENLLINAAVTMHSAEKRKESRGAHAREDFTQRDDANWMKHTLGFLPStnDKVNISYRPVHMKPLS-EE 624
145356472 546 VWNTDLVEALELHNLMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDVWMKHTLAYVEN--GKVKIDYRPNHHYTLD-AE 622
255087886 552 VWNTDLIEALELHNLMPNAQITMHSAEQRKESRGAHAREDFPDRDDANWMKHTLGWVDDk-RKVNIDYRAVIQTPLD-DE 629
303289252 552 VWNTDLIEALELHNLMPNAQITMHSAEQRKESRGAHAREDFPNRDDVSWMKHTLGFVDEk-RKVKIDYRPVHSQPLD-DE 629
302806996 541 IWNSDLIETIELENLLINAVITMQSAEARKESRGAHAREDFAKRDDENWMKHTLGFWED--GKVRLDYRPVHMNTLD-KE 617
302836143 552 VWNTDLVETLELENLLLNAAITMHGAEQRKESRGAHAREDFTERDDAKWLKHTLGYMPSveNKVSISYRPVHMQPLS-EE 630
302773241 541 IWNSDLIETIELENLLINAVITMQSAEARKESRGAHAREDFAKRDDENWMKHTLGFWED--GKVRLDYRPVHMNTLD-KE 617
219113829 628 CKTVPPVARVY 638
168056666 621 VETFPPKARVY 631
168019279 585 VETFPPKARVY 595
159463224 625 MPFIPPKPRVY 635
145356472 623 MDVIPPKARVY 633
255087886 630 MEHVPPKARVY 640
303289252 630 MEHVPPKARVY 640
302806996 618 VEPFPPKARVY 628
302836143 631 MPYIPPKARVY 641
302773241 618 VEPFPPKARVY 628
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap