Conserved Protein Domain Family
PLN00127

?
PLN00127: PLN00127 
succinate dehydrogenase (ubiquinone) cytochrome b subunit; Provisional
Statistics
?
PSSM-Id: 177738
View PSSM: PLN00127
Aligned: 7 rows
Threshold Bit Score: 208.579
Threshold Setting Gi: 224009964
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159462552   1 MQQLAASTSFGAQQFRFIGGDRVPEFWGKPSPyTGGTDFLGTPKNHLDLIKKRPLSPDVMEIDNKSAHYKFPLGALSSIT 80 
159462554  21 MQQLAASTSFGAQQFRFIGGDRVPEFWGKPSPyTGGTDFLGTPKNHLDLIKKRPLSPDVMEIDNKSAHYKFPLGALSSIT 100
145348128   1 --------------------------------------------------------------------YKFPAVALSSIT 12 
219112939   1 -MSLNVLLKQSFQRAARLQATRSMTILSK----SSGEEYKKMNYTSRMKNSGRPVSPHV-------TVYNFPIAAVASIT 68 
224009964  20 VVAITSGGSRSALPSVSVGVSRGMTILSK----ESKEEFKKENYSARMAKTRRPVSPHV-------TIYSFPVCALSSIA 88 
255073203  23 TGAGPARTDAMLAAVRGIGQVGVPENYGQVKD-GPGTKFLGTPANHRELLEKRPLSPDVFDIDGSSTHYKFPVVALSSIT 101
303285256  28 ASSLIAPTAGTLGSPRWIGDTGVPENYGQWKDgGPGTGFLGTPKNHRELLEKRPMSPDVLDIDGERVHYKFPAVALSSIT 107
159462552  81 NRVTGVALSVGFAGAGVFALRGSLDGVVAACA--------GSFLIGFPLKFLVSYAIIYHWLGGLRHIVWDvskignqaD 152
159462554 101 NRVTGVALSVGFAGAGVFALRGSLDGVVAACA--------GSFLIGFPLKFLVSYAIIYHWLGGLRHIVWDvskignqaD 172
145348128  13 NRVTGVALTGAMSAGGIIALVGGAEAVPMTMEmf----kaNAPLAVVPVKFALSFPFVFHTLGGFRHLVWD--------S 80 
219112939  69 NRVTGCVLSFGALGLGAAELLGGSGSALYIMQfv----gsQGMLISAGSKFAISFPIVYHYGGGLRHLMWD--------Q 136
224009964  89 TRVTGCILSFGAAGLGIVEIFGGSGAALSTMQcigsgemvGGALFVAGAKFSVAFPFAYHYLGGLRHLVWD--------N 160
255073203 102 NRVTGCVLSGAVAFGGSLCAVGGPEALPAFIEgf----ksTVPFLVFPAKALVGFPFVYHTLGGFRHIVWD--------K 169
303285256 108 NRVTGCVLSGGVAFGGVLSFVGGPETLPAFVEgf----ksWLPFMVYPTKLAFGFPFVYHTLGGFRHLYWD--------K 175
159462552 153 RTSLLELPKVEMSSKVLLGASAALALIAAVL 183
159462554 173 RTSLLELPKVEMSSKVLLGASAALALIAAVL 203
145348128  81 TTKGIDNESANASSLAIFGVSAAAS------ 105
219112939 137 YPEMLTNTDVAKSSYQLFAGSALISGALMFM 167
224009964 161 SPEMLTNVDVEKASYGLLGASVLLSSVAAVV 191
255073203 170 TTNGIDNASAKASSIGLFAASGAVTAALASY 200
303285256 176 TTEGIDNQSAKASSIALFAASGGISAMIAGW 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap