Conserved Protein Domain Family
PLN00126

?
PLN00126: PLN00126 
succinate dehydrogenase, cytochrome b subunit family; Provisional
Statistics
?
PSSM-Id: 165695
View PSSM: PLN00126
Aligned: 3 rows
Threshold Bit Score: 188.054
Threshold Setting Gi: 242075036
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115472415   1 MEKYQSKARFAPLSDAPFALRGALGSSNSSFNNIDHLRQSSSSGQARSYTSSPLGALRPKMFPSGNRLLHTSRPLSAPVA 80 
115443883   1 MEKYHSNSRFAPFRDAPFALRGALGSSGSSFSSIDSLRRSSTLEQARGYTSRPLGAVRPKMLPSGCRPLHTSHPLSAPVA 80 
242075036   1 MEKCNSNARFAPLSDTPFALRGALGST------------SSNLEQTRGYASSPLAAQRPKISAPGSRPLHTSRPLSSPVA 68 
115472415  81 NRPLSPHLPLKKPQLSATFSISHRIFGAALGAVIISIPLATKFSLMFDV 129
115443883  81 NRPLSPHLPLKKPQLSATFSISHRIFGAALGAAIISIPLATKFSLMFDV 129
242075036  69 NRPLSPHLPLKKPQFSATFSISHRIFGVALGVAIISVPLATKFSLMFGV 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap