Conserved Protein Domain Family
PLN00124

?
PLN00124: PLN00124 
succinyl-CoA ligase [GDP-forming] subunit beta; Provisional
Statistics
?
PSSM-Id: 177736
View PSSM: PLN00124
Aligned: 19 rows
Threshold Bit Score: 711.518
Threshold Setting Gi: 145346224
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219117017   1 MLSSTVARYALRR---------------TANPAVGAVRNLNVHEYIS--MEIMKNHGIQTPECYVASNPEEAENIFLNSL 63 
168001359   1 MVRHVASRLLARLaars--------spaPLPCLHQQSRSLNIHEYQG--AALMSKFGVNVPKGAVVSSTSEIAKVLEEQF 70 
159466790   1 MLPALTGKLLKQAtg-----------slAALSQCQQLRFFNVHEYQG--AQIMSKFGVNVPPGIPATTLDEVKKAVDQMA 67 
159466792   1 ----------------------------------------------------MSKFGVNVPPGIPATTLDEVKKAVDQMA 28 
145346224   1 MSRAIAIAIARRAtr------------eRAPWTRVARRALHVHEYQG--AEIMKKFGVRVPIGAACGTLDEVDDAARAMR 66 
255577916   1 -MRGLLNKLVSRSls------------vAGKWQQQQLRRLNIHEYQG--ADLMSKYGINVPKGVAAASIDEVRKAIQDVF 65 
255070267   1 MFRIAFRAACHRYspa---------tflFGAAVRLQNRQLNIHEYQG--AEILARHGVRVPLGIACQTADQVHAAAEKLR 69 
303280569   1 MLRASLATLRRGArag----------vaSPATQLQQIRRLNIHEYQArsAELMAQYGVRVPPGIACTTPDEVAAAAAKLS 70 
302795781   1 MARRVANVVARSRissfyplhkaiaapkSGPWE-QQLRHLNIHEYQG--ADLMSKYGVNVPKGAVVSSRKEISTVLEKEF 77 
302836393   1 MLASLVRVFAKQGlg-----------slGALSQCQQLRFFNVHEYQG--AQLMSKFGVNVPPGIPAKTLDEVAQAVEQMA 67 
219117017  64 nrpgAPKKDIVIKAQVLSGGRGLGTFKNGFKGGVHMVTKpGQAREFAAAMLGNELVTKQA-PNGIVCNKVLLMERMYMRR 142
168001359  71 ----LDDTELVVKSQVLAGGRGLGTFKNGLKGGVHIVKR-DQVEEMAGKMLGQVLVTKQTgAEGKPVNQVFLCEKLNLIN 145
159466790  68 ----DEKGEVVIKSQILAGGRGLGKFTNGLQGGVHIVPK-AKALELAKQMLGATLVTKQTgPAGKPVNTLLISKKMKLKR 142
159466792  29 ----DEKGEVVIKSQILAGGRGLGKFTNGLQGGVHIVPK-AKALELAKQMLGATLVTKQTgPAGKPVNTLLISKKMKLKR 103
145346224  67 ------GDEVVVKSQILAGGRGLGTFASGFEGGVHAVAK-TRARETAAKMLGGTLVTKQSgPAGKPVNVVYVAEKMTLTR 139
255577916  66 ----PDKSELVVKSQILAGGRGLGKFKNGFEGGVHIVKA-DKAVETAGKMLGQILVTKQTgPQGKVVSKTYGVIAMTKSN 140
255070267  70 ----SDDGDVVLKSQILAGGRGLGHFKNGLQGGVHIVPS-GKAQAVGEKMLGQLLVTKQTgAAGKPVNTVLVAQKMKLVN 144
303280569  71 ----GESGEVVVKSQVLAGGRGLGTFTSGLKGGVHIVPA-AEAKTLSEKMLGQTLVTKQTgAAGKPVNTLMVAEKMKLVN 145
302795781  78 ----PDNEELVVKSQILAGGRGLGTFKNGLKGGVHIVKR-DKVEDIAGKMLGQILVTKQTgPEGKPVNKVFICEKLQLVN 152
302836393  68 ----DENGEVVLKSQILAGGRGLGRFTNGLQGGVHIVPK-ARALELAKQMLGGTLVTKQTgPAGKPVNTLLIARKMKLRR 142
219117017 143 EMYLSILMDR----GSQGPLLVASPRGGTSIEDVAATNPEVIFTQPIDITEGLTPEGAHRMASnlGLEEGSTGHDKAVIL 218
168001359 146 EMYFAIALDR----ASAGPVMIACAKGGTSIEDLAEKYPDQIIKVPININKGISDEEAEKVVK--GLAPKKVDMQQGIDQ 219
159466790 143 EMYFAILLDR----KTAGPMMIGCSEGGTSIEDLAEKFPEKIIKIPIDIRVGITDAQAMQMVE--GLRVT-GDKAAAAKQ 215
159466792 104 EMYFAILLDR----KTAGPMMIGCSEGGTSIEDLAEKFPEKIIKIPIDIRVGITDAQAMQMVE--GLRVT-GDKAAAAKQ 176
145346224 140 EMYFAITLDR----ASAGPLVIASAEGGTSIEDLAQSHPEKIIKMRLDIERGMTKTQADELVKrlGILKHV---DEAAKQ 212
255577916 141 SDNIIFMVDDllcfLVGVLLIIACKKGGTSIEDLAEKFPDLIIKVPIDVFKGITDEDAAKVVD--GLAPKVADRNDSIEQ 218
255070267 145 EMYFAILLDR----ASAGPLVIACSEGGTSIEDLAETHPEKITRMKIDIRTGLTEAQARDIVA--HLGVK-GSVSDAVAQ 217
303280569 146 EMYFAILLDR----ASAGPMIIACSEGGTSIEDLAESHPEKIIKMKVDVNRGLTTDQALELAR--GLKVS-GSADDAAAQ 218
302795781 153 EMYFAIALDR----ASAGPVIIACSKGGTSIEDLAEKYPDMIIKVPINIHKGITDADAEKVVN--GLNLKCADKNDSMQQ 226
302836393 143 EMYFAILLDR----KTAGPMMIGCSEGGTSIEDLAEKYPEKIIKVPVDSRTGITDAQAAKMVE--GLRVT-GDKAKAAQQ 215
219117017 219 MQNLYSMFIACDCTQVEVNPLAETPEGDIVVCDAKVNFDDNAEFRQSSIFARRDTSQEDVREVDASKYDLNYIGLEGTIG 298
168001359 220 IKKFYKLFTETDCTQVEINPLAETSTGVMMAADAKLNFDDNAAFRQKEIFAMRDTTQEDPREVAAGKVDLNYIGLDGEIG 299
159466790 216 IKALYTLFDKSDCTMVEVNPLAEGLDGSLIAADAKLGFDDNAAYRQKPIFDMKDESQIDPREVAASKYDLNYIGLDGSIG 295
159466792 177 IKALYTLFDKSDCTMVEVNPLAEGLDGSLIAADAKLGFDDNAAYRQKPIFDMKDESQIDPREVAASKYDLNYIGLDGSIG 256
145346224 213 LMGLYETFSKTDCTMIEVNPLAEDQDGRVVAADAKLNFDDNAEYRQSELFSLRDTSQEDPREVQASKFDLNYIGLDGNIG 292
255577916 219 VKKLYKLFCECDCTLLEINPMAETAENQLVAADAKLNFDDNAAFRQKELFKLRDPTQEDPREVAAAKADLNYIGLDGEIG 298
255070267 218 VKALYNVFISSDCTMLEINPLAETAEAKLIAADAKLNFDDNAEYRQKGLFALRDHSQEDPREVTAGKFDLNYIGLDGNIG 297
303280569 219 LKALYAVFEKSDCTMLEVNPLAETDEKLLIAADAKLNFDDNAEYRQRELFALRDHSQEDPREVAAGKFDLNYIGLDGNIG 298
302795781 227 VKHLYDLFCKSDCTLVEINPLAETADGKLVAADAKLNFDDNASFRQQEIFALRDQSQEDAREVAAAAADLNYIGLDGEIG 306
302836393 216 IKALYDLFVKCDCTMVEVNPLAESLDGQLIAADAKLGFDDNAAYRHKEIFDLKDESQIDPREVAAAKYDLNYIGLDGSIG 295
219117017 299 CMVNGAGLAMSTMDIIQLKGGSPANFLDVGGGANETQVQKAFEILNSDSQVKAILVNIFGGIMRCDVIATGIINAAKEIG 378
168001359 300 CMVNGAGLAMATMDIIKLSGGTPANFLDVGGNATEQQVVEAFKILTSDTRVKAILVNIFGGIMKCDVIAAGIVAAAKQVN 379
159466790 296 CMVNGAGLAMATMDIIKMHGGAPANFLDVGGSANEQQVVEAFKILTGDKQVKAILVNIFGGIMKCDVIASGIVNAAKQVG 375
159466792 257 CMVNGAGLAMATMDIIKMHGGAPANFLDVGGSANEQQVVEAFKILTGDKQVKAILVNIFGGIMKCDVIASGIVNAAKQVG 336
145346224 293 CMVNGAGLAMATMDIIQLYGGSPANFLDVGGNASEEQVVEAFKILTADPKVQAILVNIFGGIMKCDVIAAGIVAAAKQVD 372
255577916 299 CMVNGAGLAMATMDIIKLHGGTPANFLDVGGNASEGQVVEAFKILTSDDKVKAILVNIFGGIMKCDVIASGIVNAAKQVA 378
255070267 298 CMVNGAGLAMATMDIISLHGAAPANFLDVGGNASEQQVVEAFKILTSDTKVQALLVNIFGGIMKCDVIASGIVSAAKQVG 377
303280569 299 CMVNGAGLAMATMDIISLHGASPANFLDVGGNASEEQVVEAFKILTADVKVKALLVNIFGGIMKCDVIASGIVNAAKQVG 378
302795781 307 CMVNGAGLAMATMDIIKLHGGSPANFLDVGGNASENQVIEAFKILTSDKKVKAILVNIFGGIMKCNVIASGIVNAAKTVS 386
302836393 296 CMVNGAGLAMATMDIIKMHGGSPANFLDVGGSANEQQVVEAFKILTSDKQVKAILVNIFGGIMKCDVIARGIVNAAKQVG 375
219117017 379 INKPIVIRLQGTNVNEAKTLIEGCGFRMILAEDLEDAAEKAVGVAEI 425
168001359 380 LKVPLVVRLEGTNVDVGKTILKESGMTIITADDLDDAAKKAVKALKQ 426
159466790 376 VQVPLVVRLEGTNVARGKEILATSGMTIITADDLDDAAKKAVASIA- 421
159466792 337 VQVPLVVRLEGTNVARGKEILATSGMTIITADDLDDAAKKAVASIA- 382
145346224 373 LKVPLIVRLEGTNVEAGNKILKSSGMTIVTAEDLDDAAQKACASLSA 419
255577916 379 LKVPVVVRLEGTNVDQGKRILKESGMTLITAEDLDDAAEKAVKAASG 425
255070267 378 LQVPLVVRLEGTNVEAGKEILEKSGMDIIAANDLDDAAKKAVSALS- 423
303280569 379 IKVPLVVRLEGTNVEAGKEILAESGLNIVSADDLDDAAKKAVAALA- 424
302795781 387 LKVPLIVRLEGTNVDLGKRILKESKMNLIAADDLDDAAEKAVAALA- 432
302836393 376 VSVPLVVRLEGTNVAQGKDIIRSSGMAIIAADDLDDAAKKAVAAIA- 421
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap