Conserved Protein Domain Family
PLN00121

?
PLN00121: PLN00121 
histone H3; Provisional
Statistics
?
PSSM-Id: 177733
View PSSM: PLN00121
Aligned: 160 rows
Threshold Bit Score: 229.556
Threshold Setting Gi: 15223698
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297844952   1 MARTKQTARKSTGGKGPRKELATKAARKTvrrPYRGGVKRAHRFRPGTVALREIRKYQKSTDLLIRKLPFQRLVREIAQD 80 
159484817   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
159464884   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
159465195   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
159465575   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
159467012   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
302829090   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
302831692   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
302843083   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
302850649   1 MARTKQTARKSTGGKAPRKQLATKAARKT---PATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD 77 
297844952  81 HKVDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPRDIQLARRIRGERA 138
159484817  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
159464884  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
159465195  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
159465575  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
159467012  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
302829090  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
302831692  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
302843083  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
302850649  78 FKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap