Conserved Protein Domain Family
PLN00119

?
PLN00119: PLN00119 
endoglucanase
Statistics
?
PSSM-Id: 177732
View PSSM: PLN00119
Aligned: 9 rows
Threshold Bit Score: 871.53
Threshold Setting Gi: 225448471
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297828165   1 MSCVSSQCLITIkSICIVLllLLSITRGAISanSNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLT 80 
15224908    1 MSCISSQCFITIkSICIVL--LLSITCGAVSanSNYGEALTKSLLYFEAQRSGKLPLDQRVIWRGDSALRDGSDAHVDLT 78 
15224906    4 LKIGSSQCLWT--SICIVLf-VLSMARGAVS--RNYGDALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLT 78 
15224903    4 LKNGSSQCLWT--SICIVLi-VMSMAREAVS--TNYAEALKNSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDAHIDLT 78 
15224896    4 SKNGSSQCLWT--SICIVVl-VMSMARGAVS--TNYAEALQKSLLYFEAQRSGKLPPNQKVTWRGDSALKDGSDAHIDLT 78 
225448471   1 ---MAPKSLLGL-GLSLLL-----LLQGAVS--VDYGSALTKSILYFEAQRSGKLPSNQRAKWRGDSALKDGGDAGVDLV 69 
225448473   1 ---MSPKTLLPL-GFSLLL-----LLQGAAS--SNYGAALTKSLLYFEAQRSGKLPPNQRVLWRGDSALQDGNDAGVDLV 69 
297828161   4 LKNGSSQYLWT--SICMVLl-VMSMAREAVS--TNYGEALRNSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLT 78 
297828163   4 LKNGSSQCLWT--SICIVLi-VMSTARGAVS--TNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLT 78 
297828165  81 GGYYDAGDNMKFGFPLAFTTTMLAWSSVEMESQLKAHHEHENTLAALRWATDYLIKAHPEPNVLYGQVGDGNLDHACWMR 160
15224908   79 GGYYDAGDNMKFGFPLAFTTTMLAWSSVEMESQLKAHQEHGNTLAALRWATDYLIKAHPEPNVLYGQVGDANLDHACWMR 158
15224906   79 GGYYDAGDNMKFGFPLAFFTTMLAWSNIEMATQLKAHQEQENALAALKWATDFLIKAHPEPNVLYGQVGDGNSDHECWMR 158
15224903   79 GGYYDAGDNMKFGFPLAFTTTMLAWSNIEMASQLRAHHEKGNALRALKWATDYLIKAHPQPNVLYGQVGEGNSDHKCWMR 158
15224896   79 GGYYDAGDNMKFGFPLAFTTTMLAWSNIEMGSELRAHHEQGNSLRALKWATDYLIKAHPQPNVLYGQVGEGNSDHKCWMR 158
225448471  70 GGYYDAGDNVKFGFPQAFTVTMLSWSVIDFGSQLSAKKELDNALAAIKWGTDYFIKAHPQANVLYGQVGDGDADHACWQR 149
225448473  70 GGYYDAGDNVKFGFPHAFTVTLLSWGVIEYGQQLAAKKELGHAMEAIKWGTDYFIKAHTQPNVLYGQVGDGDADHACWER 149
297828161  79 GGYYDAGDNMKFGFPLAFTTTMLAWSNIEMASQLRAHHEKGNSLRALKWATDFLIKAHPEPNVLYGQVGEGNSDHKCWMR 158
297828163  79 GGYYDAGDNMKFGFPLAFMTTMLAWSNIEMASQLKAHQEQENALAALKWATDFLIKAHPEPNVLYGQVGDGNSDHGCWMR 158
297828165 161 PEDMTTPRPSYRIDAQHPGADLAGETAAAMAAASLAFAPSDAAYAKTLIGHAKDLFEFAKEYPGVYHYSIPNAGGFYPSS 240
15224908  159 PEDMTTPRPSYRIDPQHPGADLAGETAAAMAAASLAFAPSDSAYAKTLISHAKELFEFAKDYPGVYHNSIPNAGGFYPSS 238
15224906  159 PEDMTTPRPSFRIDAQHPGSDLAGETAAAMAAASIAFAPSDEAYAQILIGHAKELFEFAKAYPGIYQNSITNAGGFYASS 238
15224903  159 PEDMTTPRTSYRIDAQHPGSDLAGETAAAMAAASIAFAPSDKAYANILIGHAKDLFAFAKAHRGLYQNSIPNAGGFYASS 238
15224896  159 PEDMTTPRTSYRIDAQHPGSDLAGETAAAMAAASIAFAPFDKAYANILIGHAKDLFAFAKAHPGLYQNSITNAGGFYASS 238
225448471 150 PEDMTTPRTSYKIDEQHPGSDLAGETAAAFAAASIAFSKSDPDYSSQLLGHAKQLFDFANSHQGMYQNSIPQA-HFYSSS 228
225448473 150 PEDMTTPRTSYKIDGQHPGSDLAGETAAAFAAASMAFSKSDPSYSSQLLSHGKQLFDFAKTHQGLYQNSIPQA-KFYASS 228
297828161 159 PEDMTTPRTSFRIDAQHPGSDLAGETAAAMAAASIAFAPSDKAYAQILIGHAKDLFAFAKAHRGVYQNSIPNAGGFYASS 238
297828163 159 PEDMTTPRPSFRIDAQHPGSDLAGETAAAMAAASIAFAPSDEAYAKILIGHAKDLFEFAKAYPGIYQNSITNAGGFYASS 238
297828165 241 GYEDELLWAAAWLHRATGDQTYLDYLTEASNKGGARFVFAWDDKFLGAQVLVAKLVFEGKVKNEGKMIEYKSMAEQFICN 320
15224908  239 GYEDELLWAAAWLHRATGDQTYLDHLTQASNSGGARSVFAWDDKFLGAQVLVAKLVFEGKVKNEGKMIEYKSMAEQFICN 318
15224906  239 GYEDELLWAAAWLHRATNDQIYLDYLTQASGTGGPRTAFSWDDKFVGAQVLVAKLALEGKVESNGKIAEYKSMAEQFICN 318
15224903  239 GYEDELLWAAAWLHRATNDQIYLDYLTEA-ETGGPRTVFAWDDKFVGAQVLVAKLALEGKVESSEQIVEYKSMAEQFICN 317
15224896  239 GYEDELLWAAAWLHRATNDQIYLNYLTQASGTGGPRSVFAWDDKFVGAQVLMAKLALERKVGSNGKIAEYKSMAEQFICN 318
225448471 229 GFQDELLWAAAWLYRATNDKTYSDYLSSSGNTGGTRTMFSWDDKYSGAQVLVAKFILEGKAPNDGNWGNYKNQGEQFICN 308
225448473 229 GFEDELVWAAAWLYRATNDQTYVNYLGSA-NTGGTRSEFSWDDKYTGAQVLVAKFIMEGRLPSTDNWVNYKSHAEQFICN 307
297828161 239 GYEDELLWAAAWLHRATNDQIYLDYLTQA-ETGGPRTVFAWDDKFVGAQVLVAKLALEGKVESSEEIVEYKSMAEQFICN 317
297828163 239 GYEDELLWAAAWLHRATNDQIYLDYLTQASGTGGPRTVFAWDDKFVGAQVLVAKLALEGKVESNGKIAEYKSMAEQFICN 318
297828165 321 CAQKGFNNVKKTPGGLLWFLSWDNLQYTATASFALATYAKYLEAAQTSIQCPNGGvLQAYDLLKLARAQVDYILGSNPKN 400
15224908  319 CAQKGFNNVKKTPGGLLWFLPWDNLQYTATASFALATYAKYLEAAQTSIQCPNGDvLQASDLLNLARAQVDYILGSNPKK 398
15224906  319 CAQKGSNNVKKTPGGLLYFLPWNNLQYTTAATFVLSAYSKYLTDAKASIQCPNGA-LQASDLLDLARSQVDYILGSNPQN 397
15224903  318 CAQKGDNNVKKTPGGLLYFLPWNNLQYTTAATFVLSAYSKYLEAAKASIDCPDGA-LQASDLLQVARSQVDYILGSNPQK 396
15224896  319 CAQKGSNNVKKTPGGLLYFLPWNNLQYTTTASFVLSAYSKYLTKAKASIQCPKGA-LQASDLLQIARSQVDYILGSNPQK 397
225448471 309 VIQQGSNNVKKTNAGALWWDPFNNLQYTTSALFLTASYSDSLSAAKDSLNCPAGS-ISPDDLISFARSQVDYILGKNPKG 387
225448473 308 TVQKGYNNVKMTRGGALWWLSWNNVQYTTSALLLTISYADWLNAARSNLNCPNGQ-VSPDQLIAFARLQVDYILGRNPRG 386
297828161 318 CAQKGDNNVKKTPGGLLYFLPWNNLQYTTAATFVLSAYSKYLEAAKASINCPNGA-LQASDLLHLARSQVDYILGSNPKN 396
297828163 319 CAQKGSNNVKKTPGGLLYFLPWNNLQYTAAASFVLSAYSKYLEDAKASIQCPNGA-LQASDLLDLTRSQVDYILGSNPQN 397
297828165 401 MSYMVGYGTNYPKRPHHRGASIVSIKNDPKPVTCNGGFEAWYNNPKPNPNVLVGAIVGGPDEYDAYGDERSDFQHDEPDT 480
15224908  399 MSYMVGYGTNYPKRPHHRGASIVSIKNDPKPVTCNGGFEAWYNNPKPNPNLLVGAIVGGPDEYDAYGDERSDFQHGEPDT 478
15224906  398 MSYMVGVGTNYPKKPHHRAASIVSITKDKTPVTCSEGFDAWFNNPAPNPNVLMGAVVGGPNDNDVYGDERTDYQHAEPAP 477
15224903  397 MSYMVGVGTNYPKKPHHRAASIVSIRQDKTPVTCSGGYDKWYNNPAPNPNVLAGAVVGGPDDNDVYGDERSNFQQAEPAT 476
15224896  398 MSYMVGVGTNYPKKPHHRAASIVSIRKDKTPVTCSGGYDKWYNNPAPNPNVLMGALVGGPNENDVYGDERSNFQQAEPAT 477
225448471 388 MSYMVGYGSSFPQQVHHRGASIVSIHENGAPVTCQEGFDKWYNRQAPNPNVLEGAIVGGPDQGDNYGDSRSNFQQAEAAT 467
225448473 387 MSYMLGYGARFPQQLHHRGSSIVSIKKDKRLVTCTGGYTEWFNRQAPNPNIVYGAIAGGPDQYDNYNDSRPNYEQAESAT 466
297828161 397 MSYMVGVGTNYPKKPHHRAASIVSIHKDKTPVTCSGGFNAWYNNPAPNPNVLAGAVVGGPDDNDVYGDERTNFQQAEPAT 476
297828163 398 MSYMVGVGTNYPKKPHHRAASIVSITKDKTPVTCSEGFDAWFNNPAPNPNVLMGAVVGGPNDNDVYGDERTDYQHAEPAP 477
297828165 481 VTVAPLVGVLAAIA 494
15224908  479 VTVAPLLGVLAAIA 492
15224906  478 ATAAPFVGVLAAVA 491
15224903  477 VTTAPLVGVLALVF 490
15224896  478 VTVAPFVGVLAAVF 491
225448471 468 ANSGPIVGVLARLA 481
225448473 467 VNTAPFVGVLARLA 480
297828161 477 VTAAPLVGVLALVA 490
297828163 478 ATAAPFVGVLAAVA 491
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap