Conserved Protein Domain Family
PLN00116

?
PLN00116: PLN00116 
translation elongation factor EF-2 subunit; Provisional
Statistics
?
PSSM-Id: 177730
View PSSM: PLN00116
Aligned: 33 rows
Threshold Bit Score: 1539.67
Threshold Setting Gi: 161899525
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
303280770   1 MVKFSIDELRRQMDKQHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAAENAGDARLTDTRQDEQDRCITIKSTGISLFYK 80 
219118664   1 --------MRSIMDLKHNIRSMSVIAHVDHGKTTLTDSLVQKAGIISSKAAGGARYTDTRADEAERGITIKSTGISMFFE 72 
145356981   1 MVKFTIDELRKQMDHNKNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQENAGDARLTDTRQDEQDRCITIKSTGISLFYT 80 
159490505   1 MVKFTMEEIRALMDKPHNIRNMSVIAHVDHGKSTLTDSLVAAAGIMAVEQAGDARLTDTRADEQERGITIKSTGISLYYQ 80 
162605796   1 MVNFTIDQIHAIMSKKNNIRNISVIAHVDHGKSTLTDSLVASAGIISLDSAGEARLTDTRADEQERGITIKSTGISLYFD 80 
242058551   1 MVKVTAGQLRASMNKKHNIRNISVIAHVDHGKSTLTDSLVAAAGIIAQDAAGGVRMTDTRADEAERGITIKSTGISLYYE 80 
224002995   1 MVNFTVDQMRAIMDMKHNIRSMSVIAHVDHGKTTLTDSLVQKAGIISSKAAGGARYTDTRKDEAERGITIKSTGISMFFE 80 
255086964   1 -PQFTIDELRRQMDKKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQENAGEARLTDTRQDEQDRCITIKSTGISLFYT 79 
160330969   1 MANFSIEQVREIMSRKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIISLDSAGDARLTDTRADEQERCITIKSTGITLFFE 80 
302832700   1 MVKFTIEEIRALMDKKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIMAIEQAGDARLTDTRADEQERGITIKSTGISLYYQ 80 
303280770  81 MDEESLalipKHVPREPDCNDYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCVEGVCVQTETVLRQALGERIKPVMT 160
219118664  73 Y---------DMKAGEISEKSYLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIDGVCVQTETVLRQAIAERVKPVLM 143
145356981  81 VSDEDLarlpKDVP--RDGNNYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCVEGVCVQTETVLRQALGERIKPVMT 158
159490505  81 MTDDDL----KNFTGQRDGNDYLVNLIDSPGHVDFSSEVTAALRITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLT 156
162605796  81 IQND------IDLPSDCEGKEFLVNLIDSPGHVDFSSEVTAALRVTDGALVVVDCIEGVCVQTETVLRQALLERIKPVLT 154
242058551  81 MGAARF---------GGGTSSYLINLVDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALAERIKPVLV 151
224002995  81 Y---------DVKAGEITENSYLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIDGVCVQTETVLRQAISERVKPVLM 151
255086964  80 MADEDLarmpKHVP--RDGNDYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCVEGVCVQTETVLRQALGERIRPVMT 157
160330969  81 FPSE------LGLPPNSEGKEFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCIEGVCVQTETVLRQALLERIKPVLT 154
302832700  81 MTDEDL----KNFTGEREGNDYLVNLIDSPGHVDFSSEVTAALRITDGALVVVDCVEGVCVQTETVLRQALAERIRPVLT 156
303280770 161 VNKLDRCFLELMLDGEEAYQNFCRVIENANVLMATYTDDALGDCQVAPEKGTVSFSAGLHNWAFTLTVFAKMYAAKFGVE 240
219118664 144 VNKVDRALLELQLPAEELYQAFCRSIESVNVIVATYNDELLGDVQVHPTKGTVAFGSGLHQWAFTLKRFARDYGSKFGVP 223
145356981 159 VNKLDRCFLELMLDGEEAYQNFCRVIENANVIMATYTDEALGDVQVAPEKGTVCFSAGLHNWAFTLTVFAKMYAAKFGID 238
159490505 157 VNKMDRCFLELMLEGEEAYTTYLRVIENANVIMATYQDEAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTD 236
162605796 155 INKLDRAFLELQCENEEMYRTFYKVIENVNVIMVTYQDDLLGDVQVSPEVGNVAFSAGLHGWAFTLSQFARMYAKKWKIE 234
242058551 152 VNKMDRCFLELQQNGEEAYQAFCRVIENANVVISTYEDSKLGDCQVSPEKGTVAFSAGLHGWAFTLSDFAKMYAAKFNVD 231
224002995 152 VNKVDRALLELQLPAEELYQAFCRAIESVNVIVAMYNDEALGDIQVDPTKGSVAFGSGLHQWAFTLKRFAKTYGAKFNVP 231
255086964 158 VNKLDRCFLELMLDGEEAYQNFCRVIENANVLMATYTDEALGDCQVGPEKGTVSFSAGLHNWAFTLTVFASMYAKKFGVE 237
160330969 155 INKLDRAFLELQAESEDIYKNCLRVIENSNVIMATYQDDLLGDVQVSPEKNTVSFSAGLHGWAFNLGQFARMYATKWKIQ 234
302832700 157 VNKMDRCFLELMLEGEEAYTTYLRVIENANVIMATYQDDAMGDIQVYPDKSTVSFSAGLHGWAFTLTTFARMYASKFGTD 236
303280770 241 FDKMME-------KLWGDNFFDPKTKKWTKKHTGEKTCMRAFVQFIYEPIRRVIDAAMND---NKEKLWPMLEKLKVKek 310
219118664 224 EDKMME-------KLWGDWYFDAPRKVWTSSD-KGGTLERAFCQFIATPITSLFEAIMAE---KAGKVKKMLKAIDVE-- 290
145356981 239 QDAMMG-------KLWGDNFFDPKERKWTKKNTGSKTCMRAFVQFCYEPIRRVIDAAMND---NKDKLWPMLEKLQVKdr 308
159490505 237 EARMIT-------KLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKQIIELAMKD---AKDKLWPMLEKLNVIgr 306
162605796 235 GEKLNEftkkltlKLWGDNFFDPSSKKWTKKE--DNSIERSFSHFILNPIKKIINYAMSD---KVDEIVKAMEGFSIK-- 307
242058551 232 EARMTE-------RLWGEHFFDPATRSWSTRHTGSPTCQRGFVQFCYQPIRQIIQACMTDgggGKETLWPMLHKLSVS-- 302
224002995 232 EDKMMA-------KLWGDWYFDAGRKVWTTAN-KDGSLERAFCQFIATPITTLFEAIMAE---KHKKVEKMLKAIGVE-- 298
255086964 238 VDKMME-------KLWGDNFFDPKTKKWTKKHTGEKTCQRAFVQFIYEPIRRVIDAAMND---NKEKLWPMLEKLGVKak 307
160330969 235 DEKKSEfiekltsRLWGDNFFDVETKKWLKKE--KKGATRAFVHFIINPIKKIVKLAMSD---RVKELEEALSSFDIK-- 307
302832700 237 EARMIQ-------KLWGDNFFDPATKKWTTKQTDSPSCKRGFVQFIYEPIKTIIDLAMKD---AKEKLWPMLEKLNVIgr 306
303280770 311 LKPADFDL-LGKPLMKRIMQTWLPADVALLEMIIFHLPSPATAQKYRADTLYEGPLDDKYAESIRNCD--SSGPLMLYVS 387
219118664 291 LKGDEKEL-VGKQLLKRVMQKWLPAGDAVLEMIVLHLPSPAKAQRYRVDTLYDGPLDDATATAIRTCDtsPNAPLCMYIS 369
145356981 309 LKPADLDL-MGKPLMKRIMQTWLPADVALLEMIIYHLPSPATAQKYRADTLYEGPLDDAYANAIRECD--ANGPLMLYVS 385
159490505 307 LKSDDKEL-SGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQRYRVDVLYEGPLDDTYATAIRNCD--PNGPLMVYIS 383
162605796 308 ITNDDKSL-KQKNLMKRVLQKWLPADQALKEMIIHHLPSPARAQFYRVGNLYEGPLNDEFAESIKKCD--SNGPLMVYIS 384
242058551 303 LKAVDRELsAGKALMKRVMQAWLPASAALLEMIVFHLPSPAKAQQYRVETLYEGPLDDAYAAGIRSCD--PEGPLMLYVS 380
224002995 299 LKSEEKEL-VGKALLKRVMQKWLPAGDTVLEMIVLHLPSPFKAQQYRVDTLYNGPLDDATATAIRTCDtrEGAPLCMYIS 377
255086964 308 LKPADFDL-MGKPLMKRIMQTWLPADVALLEMIIYHLPSPATAQKYRADTLYEGPLDDKYAEAIRNCD--ADGPLMLYVS 384
160330969 308 LSGEDKKL-TQKHLMKKVLQKWLPASSALLETIVINLPSPAKAQSYRVQNLYEGPMDDETALSIKNCD--ASGPLMVYIS 384
302832700 307 LKSEDKEL-SGKPLMKRIMQSWLPANEALLEMIVYHLPSPAKAQKYRVDVLYEGPLDDLYATAIRNCD--PTGPLMCYVS 383
303280770 388 KMIP-TADKGRFLAFGRVFSGKVKTGMKVRILGPNYVPGEKKDLYVKSIQRTVLCMGRRQDAVEDVPAGNTVAMVGLDQF 466
219118664 370 KMVP-TSDKGRFYAFGRVFSGTIATGQKVRIMGANFVPGKKSELWIKNIQRTVIMMGRYTEQVADVPAGNTCALVGVDQY 448
145356981 386 KMIP-TADKGRFLAFGRVFSGTVQTGQKVRIMGPNYVPGEKKDLYIKSIQRTVLCMGRRQDAIDNVPCGNTVAMVGLDQF 464
159490505 384 KMIP-TADKGRFFAFGRVYSGKVATGAKVRIMGANYIPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQY 462
162605796 385 KMIP-SSDKGRFIAFGRVFSGTIKTGQKIRIMGSNYIPGKKTDLSIKNVQRVLLMMGRKVEIIDNLPAGNTVGIVGIDQC 463
242058551 381 KMIPaASDKGRFYAFGRVFSGTVATGTKVRIMGPNYVPGGKKDLFVKTVQRTVIWMGKRQESVDDVPCGNTVALVGLDHF 460
224002995 378 KMVP-TSDKGRFYGFGRVFSGTIATGQKVRILGPNYVPGKKTDLWVKNIQRTVIMMGRYTEQVADVPAGNTCALVGVDQY 456
255086964 385 KMIP-TADKGRFLAFGRVFSGKVQTGQKVRILGPNYVPGEKKDLYVKSIQRTVLCMGRRQDAVENVPCGNTVAMVGLDAF 463
160330969 385 KMIP-STDKGRFVAFGRVFAGTVKTGQKVRIMGPSYIPGKKTDLVIKNIQRTLLMMGKKTELVDSIPAGNTVGLVGIDQF 463
302832700 384 KMIP-TNDKGRFFAFGRVFAGKVATGAKVRIMGANYVPGEKKDLYNKSVQRTVLCMGRKQEAVEDVPCGNTVALVGLDQY 462
303280770 467 ISKNATITGEQEVEAHPLKAMKFSVSPVVRVAVECKNSQDLPKLVEGLKRLSKSDPMVLCQIEETGEHIVAGAGELHLEI 546
219118664 449 LLKSGTIATAE--DACPIKSMKFSVSPVVRCAVEPKNSADLPKLVEGMKRLAKSDPMVLCYTEESGEHIIAASGELHLEI 526
145356981 465 IQKNATITGEKDVDAHTIKAMKFSVSPVVRVAVECKNSQDLPKLVEGLKRLSKSDPMVQCQIEETGEHIVAGAGELHLEI 544
159490505 463 ITKTATITKEGCDDAFPMKAMKFSVSPVVRVAVEPKNASDLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAGELHLEI 542
162605796 464 LVKSGTISDSE--NAYPMKNMKYSVSAVVRVAVEPKNPSDLPKLIEGLKRLSKSDPLVQCMTEESGEHIVAGAGELHLEI 541
242058551 461 ITKSATLTDDRAVDAHPMKAMRFSVSPVVHKSVACRNAADLPKLVEGLKRLAKSDPLVVCTVTETGEHVVAGVGDLHLEI 540
224002995 457 LLKTGTIVTEE--DAHTIKSMKFSVSPVVRCAVEPKNSADLPKLVEGMKRLSKSDPMVLCYTEESGEHIIAASGELHLEI 534
255086964 464 ISKNATITGEQETEAHPLKAMKFSVSPVVRVAVECKNSQDLPKLVEGLKRLSKSDPMVQCQIEETGEHIVAGAGELHLEI 543
160330969 464 LLKSGTLSDSE--SAFPLKSMKYSVSPVVRVAIEPKNPSDLPKLVEGLKRLSKSDPLVQCKIEESGEHIIAGAGELHLEI 541
302832700 463 ITKTATITKEGCEDAFPMKAMKFSVSPVVRVAVEPKNAADLPKLVEGLKRLARSDPMVQCIIEETGEHIIAGAGELHLEI 542
303280770 547 CLKDLQEDFMGGAEIRISDPVVSFRESVNN----TSDHICMSKSPNKHNRLYFQATCMEEGLAEAIDDGD-VTPRDEPKA 621
219118664 527 CLQDLQNDFM-GTEVKVSDPVVSFRETCTE----KSSQTCLAKSANKHNRLFVEAEPLGPELCKAIDDGD-IKAGNDAKI 600
145356981 545 CLKDLQEDFMGGAEIRISDPVVSFRETVNG----TSDHICMSKSPNKHNRLYFQAVAMDEGLAEAIDNGE-VTPRDDPKT 619
159490505 543 CLKDLQDDFMGGAEIKISEPVVSFRETVTA----QSDHTVMSKSPNKHNRLYIQARPMEDGLAEAIESGR-VGPRDDPKI 617
162605796 542 CLKDLQDDFMNGAELKISQPIVSYRETVEGvinpEETAVCLSKSPNKHNRIYCYAEPLPEGLSEAIDDGK-IKSSDEPKT 620
242058551 541 CLKDLRQDFMGGAEIVVGPPVVSYRETVLA----RSCRTVMSKSPNKHNRLYMEAWPLQKELAEAIDDDElVGSKDDTKV 616
224002995 535 CLQDLQQDFM-GTEVKVSDPVVSFRETCQG----KSDQTCLAKSANKHNRLFVEADALGAELCDAIDNGD-IFAGAEAKI 608
255086964 544 CLKDLQEDFMGGAEIRISDPVVSFRETVNG----TSDHMVMSKSPNKHNRLYFQATCMEEGLAEAIDNGD-VTPRDEPKA 618
160330969 542 CLKDLQEDFMNGAEIRVSQPVVSFRETVEGvpnpQEKGLCLSKSPNKHNRIYCYAEPLPEGLPEAIDEGK-ITPRDDIKI 620
302832700 543 CLKDLQDDFMGGAEIKISEPVVSFRETVTA----QSDHTVMSKSPNKHNRLYIQARPMEDGLPEAIESGK-VGPRDDPKI 617
303280770 622 RGRFLAEKFGWDKDL-SKKIWCFGPDTTGPNLIVDMCKGVQYLNEIKDSCVAAFQWATKEGPIAEENMRGIKFEVHDVVL 700
219118664 601 QGRKLADEFGWDVSE-ARKIWAFGPEGTGPNLFVDTTKGVNYLLEIKESVVGGFAWATQNGPLCDEQLRGCRFNLMDVVL 679
145356981 620 RGRFLADKYGWDKDLgAKKIWCFGPDTTGPNLIVDMCKGVQYLNEIKDSCVAAFQWATKEGVLAEENMRGIKFEIHDVVL 699
159490505 618 RSKILSEEFGWDKEI-AKKIWCFAPDTNGANMMIDVTKGVQYLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVL 696
162605796 621 RIKELKQKFDMNEED-IKKIWCFGPDGNGPNFLVDRTKGLQYINEIKDSCNSGFQWATKEGVLCGENIRGVLFKIVDVTL 699
242058551 617 RAKVLSEEFGWDKDV-AKKIWCFGPEATGPNMVVDMCRGVQYVGEIRDSVVAGFQWASKEGALAEESMRGVCFELRDVVL 695
224002995 609 QGRKLADDFGWDVSE-ARKIWAFGPEGTGPNLFVDTTKGVNYLLEIKESVVGGFAWATQNGPLCEEQMRGTRFNLMDVVL 687
255086964 619 RGRYLAEKFGWDKDL-SKKIWCFGPDTTGPNMIVDMCKGVQYLNEIKDSCVAAFQWATKEGVMSEENMRGIKFEVHDVVL 697
160330969 621 RAKELKNSYQMDEES-VKKIWCFGPEGNGPNFLLDCTKSIQYLNEIKDSCVSAFQWATKEGALCNENMRGISFNILDVTL 699
302832700 618 RSKILSEEYGWDKEI-AKKIWCFAPDTNGANMMVDVTKGVQYLNEIKDSCVAAMQWACKEGVLAEENMRGIVFEFMDVVL 696
303280770 701 HTDAIHRGGGQIIPTCRRVLYASMMTAEPKLLEPVYLVEIQAPEGALGGIYSTITQKRGMVIEEMQRPGTPIYNIKAYLP 780
219118664 680 HADAIHRGMGQIMPTSRRVCFASMMAGGPGILEPIYLCNISVPQDAMGNVYGVLTRRRGHVFTEEQRPGTPQMTLLAYLP 759
145356981 700 HTDAIHRGGGQIIPTCRRVLYASALTAEPRLLEPVYLVEIQAPEQALGGIYSTVTQKRGMVIEETQRPGTPIYNIKAYLP 779
159490505 697 HTDAIHRGGGQIIPTARRVIYAAELTAQPRLCEPVYLVEIQAPEQALGGIYSTLNTKRGMVFEEMQRPGTPMYNIKAYLP 776
162605796 700 HADAIHRGGGQIIPTARRCFHGAQLLANPKLLEPVYLVEIQCHENSVGSIYGVLNRKRGHVFEESQRPGTPIFNVKAYLP 779
242058551 696 HADAIHRGGGQIIPTARRAIYAAQLTAMPRLMEPVYLVEIQAPERATGSIYSLLNKKRGSVIEERQRPGTPLINFKAYLP 775
224002995 688 HADAIHRGMGQIMPTARRVCFSSMMTAEPGLLEPVYLCNISVPQDAMGNVYGVLTQRRGHVFSEEQRPGTPQMTLLAYLP 767
255086964 698 HTDAIHRGGGQIIPTCRRVLYASALTAEPRMMEPVFLVEIQAPEQALGGIYSTITQKRGMVIEEQQRPGTPIYNIKAYLP 777
160330969 700 HADSIHRGGGQIIPTARRCFLGAQLLGKPRLMEPVYLVEIQCPENAVGSIYGVLNRKRGHVFEETQRFGTPIFNIKAYLP 779
302832700 697 HTDAIHRGGGQIIPTARRVIYAAELVSQPRLCEPVYLVEIQAPENALGGIYSTLNTKRGMVFEEAQRPGTPMYNIKAYLP 776
303280770 781 VMESFGFTGTLRAATSGQAFPQCVFDHWDMLGSDPYDTNSQAGKLVLDIRKRKGIKEFIPALSEYEDKL 849
219118664 760 VMESFGFTADLRSNTGGKAFPQCSFDHWEPMSGSPFDEGTKTNEVVVSVRKRKGLADGVPEANKYLDKL 828
145356981 780 VMESFGFTGTLRAATSGQAFPQCVFDHWDMLNSDPLNPDSQSGKLVKDIRKRKGSKENVPPLNEYEDKL 848
159490505 777 VVESFGFTSVLRANTAGQAFPQCVFDHWDVMPMNPLDKGTQANTLVTNIRTRKGLKPEPAPLSEYEDKL 845
162605796 780 VQESFGFTADLRAATGGQAFPQCVFDHWQIVQGNPLDKNDKCHEIVKNIRKRKGLKEEIPGIENFLDKL 848
242058551 776 VTESLEFSEKLRAETSSEAFPQCVVDHWEAINSDPLEEGSMAAKLIAGIRKRKGLKN-MIPLSEFEDRL 843
224002995 768 VMESFGFTADLRSNTGGKAFPQCSFDHWEPMGGSVYGGGKVADTILA-VRARKGLKDGIPEISQYLDKL 835
255086964 778 VMESFGFTGTLRAATSGQAFPQCVFDHWDMIGSDPLDPGSQAGKIVCDIRKRKGIKENVPALSEYEDKL 846
160330969 780 VQESFGFTADLRAATSGQAFPQCVFDHWQIIQGDPLEKTDKTSDLVSSIRKRKGLKEEIPGVENYYDKL 848
302832700 777 VVESFGFTSVLRANTSGQAFPQCVFDHWDVMPMNPLEKGNQANTLVTNIRTRKGLKPEPAPLSEYEDKL 845
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap