Conserved Protein Domain Family
PLN00115

?
PLN00115: PLN00115 
pollen allergen group 3; Provisional
Statistics
?
PSSM-Id: 177729
View PSSM: PLN00115
Aligned: 22 rows
Threshold Bit Score: 133.374
Threshold Setting Gi: 297606312
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242072033   2 ASSSSFLLAMAALAALFAVGLCGNSVTLTVGKGTTPtyTHLVLVANLPIHELAIREKGAAEFLdDMKESPAKTFTQDSKA 81 
115457700   1 MASMSSFRLAVAAAALLVIGSCATELTFKVAEGSSA--TSLELVTNVAISEVEVKEKGGKDWV-GLKESGSNTWTLKSEA 77 
242072035   2 ASSSSFLLAMAALAALFAVGLCGNSVTLTVGKGTTPtyTHLVLVANLPIHELAIREKGAAEFLdDMKESPAKTFTQDSKA 81 
242072037   1 -----------ALAALFAVGLCGNTVTLTVGKGTTPtyTHLVLVANLPIHELAIREKGAAEFLdDMKESPAKTFTQDSKA 69 
242040561   2 ASSSSFLLAMAALAALLAVGSCSTLMTWTIGKDSTS--TRLVLVASADVSEVAVKDKGATDFSdDLKESPAKTFTYESKE 79 
242084676   4 SSSFCFLLAAVALTALFAIGSCGTTLTIEVGKDSTS--TKLSLITNVAISEVSVKPKGATDFTdDLKESEPKTFTLDSKE 81 
242084678   4 SSSFCFLLAVVALAALFAIGSCGTTLTIEVGKDSTS--TKLSLITNVAISEVSVKPKGATDFTdDLKESEPKTFTLDSKE 81 
242084680   4 SSSFCFLLAVVALAALFAIGSCGTTLTIEVGKDSTS--TKLSLITNVAISEVSVKPKGATDFTdDLKESEPKTFTLDSKE 81 
242084682   4 SSSFCFLLVVVALAALFAIGSCGTTLTIEVGKDSTS--TKLTLITNVAISEVSVKPKGATDFTdDLKESEPKTFTLDSKE 81 
242084684   4 SSSFCFLLAVVALAALFTIGSCGTTLTIEVGKDSTS--TKLSLITNVAISEVSVKPKGATDFTdDLKESEPKTFTLDSKE 81 
242072033  82 PLKGPLSVRFAVKGGGYRNRDEIFPVGLKPGAVINTNIPF 121
115457700  78 PLKGPFSVRFLVKNGGYRVVDDVIPESFTAGSEYKSGIQL 117
242072035  82 PLKGPLSVRFAVKGGGYRNRDEIFPVGLKPGAVINTNIPY 121
242072037  70 PLKGPLSVRFAVKGGGYRNRDEIFPVGLKPGAVINTNIPF 109
242040561  80 PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQV 119
242084676  82 PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQV 121
242084678  82 PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQV 121
242084680  82 PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQV 121
242084682  82 PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQV 121
242084684  82 PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQV 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap