Conserved Protein Domain Family
PLN00110

?
PLN00110: PLN00110 
flavonoid 3',5'-hydroxylase (F3'5'H); Provisional
Statistics
?
PSSM-Id: 177725
View PSSM: PLN00110
Aligned: 12 rows
Threshold Bit Score: 987.041
Threshold Setting Gi: 225436666
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224105985   1 MVL-LWELTMAALFFFINYLLTRCL--IRKLSTRqLPPGPRGWPIIGAIPVLGAMPHAALAKMAKQYGPVMYLKMGTCNM 77 
224105987   5 MVL-LWELTMAALFFFINYLLTRCL--IRKLSTRqLPPGPRGWPIIGAIPVLGAMPHAALAKMAKQYGPVMYLKMGTCNM 81 
224055291   5 PVL-PGKLTLAALLFFISYQFTGSF--IRKLLHR-YPPGPRGWPIIGAIPLLGDMPHVTLAKMAKKHGPVMYLKMGTRDM 80 
225466541   5 TSL-LPELAAATLLFFITRFFIRSL--FPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 80 
225467596   5 TSL-LLELAAATLLFFITRFFIRSL--LLKSSRK-LPPGPKGWPLVGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 80 
225467598  10 TSL-LLELAAATLLFFITRFFIRSL--LLKSSRK-LPPGPKGWPLVGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 85 
225469434   5 TSL-LLKLAAAILLFFITRFFIRSL--LPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNCM 80 
225469436  10 TSL-LLKLAAAILLFFITRFFIRSL--LPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNCM 85 
225436670   5 TSL-LPELAAATLLFFITRFFICSL--FPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTSSM 80 
225436672   5 TSL-LPELAAATLLFFITRFFIRSL--FPKPSRK-LPPGPRGWPLLGALPLLGNMPHVALAKMAKRYGPVMFLKMGTNSM 80 
225436666   5 TSF-FIVSAAATLLFLIVHSFIHFL--VSRRSRK-LPPGPKGWPLLGVLPLLKEMPHVALAKMAKKYGPVMLLKMGTSNM 80 
225441222   5 TMVqIDELLFTALVFLVTNFFVKRItsMSRSSRR-LPPGPRGWPVVGCLPLLGAMPHVALAQLAQKYGAIMYLKLGTCDV 83 
224105985  78 VVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAHVRVSELGHML 157
224105987  82 VVASTPDAARAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAHVRVSELGHML 161
224055291  81 VVASNPDAARAFLKTLDLNFSNRPIDGGPTHLAYNAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWAPVRVTELGHML 160
225466541  81 VVASTPEAARAFLKTLDINFSNRPPNAGATHLAYGAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDSSQVRTVELGHML 160
225467596  81 VVASTPGAARAFLKTLDINFSNRPPNAGATLLAYHAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRAVELGHML 160
225467598  86 VVASTPGAARAFLKTLDINFSNRPPNAGATLLAYHAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRAVELGHML 165
225469434  81 VVASTPEAAQAFLKTLDINVSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWSQVRTVELGHML 160
225469436  86 VVASTPEAAQAFLKTLDINVSNRPPNAGATHLAYDAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDWSQVRTVELGHML 165
225436670  81 VVASTPEAARAFLKTLDINFSNRPPNAGATHLAYGAQDMVFADYGPRWKLLRKLSNLHMLGGKALEDSSQVRTVELGHML 160
225436672  81 VVASTPEAARAFLKTLDINFSNRPPNAGATHLAYDAQDMVFADYGARWKLLRKLSNLHMLGGKALEDWSQVRTVELGHML 160
225436666  81 VVASNPEAAQAFLKTHEANFLNREPGAATSHLVYGCQDMVFTEYGQRWKLLRRLSTLHLLGGKAVEGSSEVRAAELGRVL 160
225441222  84 VVASKPDSARAFLKTLDLNFSNRPPNAGATHIAYEAQDFVFADIGPRWNLLRKLTSLHMLGAKSFKDWGAIRGAEIGHMI 163
224105985 158 RAMCEASRKGEPVVVPEMLTYAMANMIGQIILSRRVFVTKGSESNEFKDMVVELMTSAGLFNVGDYIPSVAWMDLQGIER 237
224105987 162 RAMCEASRKGEPVVVPEMLTYAMANMIGQIILSRRVFVTKGSESNEFKDMVVELMTSAGLFNVGDYIPSVAWMDLQGIER 241
224055291 161 RAMCEASRKGDPVVVPEMLTYAMANMIGQIILSRRVFVTKGSESNEFKDMVVELMTSGGFFNIGDFIPSVAWMDLQGIER 240
225466541 161 RAMLELSQREEPVVVPEMLSFSIANIIGQVILSRRVFETKGSESNEFKDMVVELMTCAGYFNIGDFIPSIAWMDIQGIER 240
225467596 161 RAMLELSQRAEPVVVPEMLTFSMANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIQR 240
225467598 166 RAMLELSQRAEPVVVPEMLTFSMANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIQR 245
225469434 161 RAMLELSQREEPVVVPEMLSFSVANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIER 240
225469436 166 RAMLELSQREEPVVVPEMLSFSVANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIER 245
225436670 161 RAMLELSQREEPVVVPEMLSFSIANIIGQVILSRRVFETKGSESNEFKDMVVELMTCAGYFNIGDFIPSIAWMDIQGIER 240
225436672 161 RAMLELSQREEPVVVPEMLSFSVANMIGQVILSRRVFETKGSESNEFKDMVVELMTTAGYFNIGDFIPSIAWLDIQGIER 240
225436666 161 QTMLEFSQRGQPVVVPELLTIVMVNIISQTVLSRRLFQSKESKTNSFKEMIVESMVWAGQFNIGDFIPFIAWMDIQGILR 240
225441222 164 QAMCELSRRGEPVVVPEMVSCALANIIGQKSLSRRVFETQGSESNDFKEMVVELMRLAGLFNVGDFIPSIAWMDLQGTEG 243
224105985 238 GMKRLHRRFDVLLTKMMEEHIATAHERKGKPDFLDVLMANQEN-LDGEKLSFTNIKALLLNLFTAGTDTSSSIIEWSLAE 316
224105987 242 GMKRLHRRFDVLLTKMMEEHIATAHERKGKPDFLDVLMANQEN-LDGEKLSFTNIKALLLNLFTAGTDTSSSIIEWSLAE 320
224055291 241 GMKKLHRRFDVLLTKMIEDHSATSHERKGKPDFLDVLMANQEN-SDGARLCLTNIKALLLDLFTAGTDTSSSVIEWALAE 319
225466541 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQEN-TTGEKLTLSNIKALLQNLFAAGTDTSASIIEWSLAE 319
225467596 241 GMEHLHRKFDWLLTKMMEEHTASAHERKGNPDFLDVIMANQEN-STGEKLTITNIKALLLNLFTAGTDTSSSVIEWSLAE 319
225467598 246 GMEHLHRKFDWLLTKMMEEHTASAHERKGNPDFLDVIMANQEN-STGEKLTITNIKALLLNLFTAGTDTSSSVIEWSLAE 324
225469434 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQGN-STGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAE 319
225469436 246 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQGN-STGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAE 324
225436670 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQEN-TTGEKLTLSNIKALLQNLFAAGTDTSASIIEWSLAE 319
225436672 241 GMKHLHKKFDKLLTRMIEEHTASAHERKGNPDFLDVVMGHQGN-STGEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAE 319
225436666 241 QMKRVHKKFDKFLTELIEEHQASADERKGKPDFLDIIMANQEDgPPEDRITLTNIKAVLVNLFVAGTDTSSSTIEWALAE 320
225441222 244 KMKLLHNKFDALLTRMIEEHSATAHERLGNPDILDVVMAEQEY-SGGVKLSMVNIKALLLNLFIAGTDTSSGTIEWALAE 322
224105985 317 MLKNPRILKQAQDEMDQVIGRNRRLEESDIPKLPYLQAICKETFRKHPSTPLNLPRIADQACEVNGYYIPKGTRLSVNIW 396
224105987 321 MLKNPRILKQAQDEMDQVIGRNRRLEESDIPKLPYLQAICKETFRKHPSTPLNLPRIADQACEVNGYYIPKGTRLSVNIW 400
224055291 320 MLKNQSILKRAQEEMDQVIGRNRRLVESDIPKLPYLQAVCKETFRKHPSTPLNLPRIADQACEVNGYYIPKGARLSVNIW 399
225466541 320 MLKNPSILKRAQEEMDHVIGRNRRLVESDLPKLPYLQAICKESLRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 399
225467596 320 MLKNPSILKRAHEEMDKVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 399
225467598 325 MLKNPSILKRAHEEMDKVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 404
225469434 320 MLKNPSILKRAHEEMDQVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSAQACEVNGYYIPKNTRLSVNIW 399
225469436 325 MLKNPSILKRAHEEMDQVIGRSRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSAQACEVNGYYIPKNTRLSVNIW 404
225436670 320 MLKNPSILKRAQEEMDHVIGRNRRLVESDLPKLPYLQAICKESLRKHPSTPLNLPRVSTQACEVNGYYIPENTRLSVNIW 399
225436672 320 MLKNPSILKRAHEEMDQVIGRSRRLVESDLQKLPYLQAICKESFRKHPSTPLNLPRVSNEACEVNGYYIPKNTRLSVNIW 399
225436666 321 MLKKPSIFQRAHEEMDQVIGRSRRLEESDLPKLPYLRAICKESFRLHPSTPLNLPRVASEACEVNGYYIPKNTRVQVNIW 400
225441222 323 ILKNPTMLKRAHAEMDRVIGKNRLLQESDVPKLPYLEAICKETFRKHPSVPLNIPRVSANACEVDGYYIPEDTRLFVNVW 402
224105985 397 AIGRDPDVWDNPLDFTPERFFSEKYAKINPQGNDFELIPFGAGRRICAGTRMGIVLVQYILGTLVHSFDWKLPKDVELNM 476
224105987 401 AIGRDPDVWDNPLDFTPERFFSEKYAKINPQGNDFELIPFGAGRRICAGTRMGIVLVQYILGTLVHSFDWKLPKDVELNM 480
224055291 400 AIGRDPDVWDNPEVFTPERFFTEKYAKINPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKLPEDVDLNM 479
225466541 400 AIGRDPDVWENPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKIPDGVEINM 479
225467596 400 AIGRDPDVWESPEEFRPERFLSGRNEKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKMPDGVEINM 479
225467598 405 AIGRDPDVWESPEEFRPERFLSGRNEKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKMPDGVEINM 484
225469434 400 AIGRDPDVWESPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGSLVHSFDWKMPDGVEINM 479
225469436 405 AIGRDPDVWESPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGSLVHSFDWKMPDGVEINM 484
225436670 400 AIGRDPDVWENPEEFRPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKMPDGVEINM 479
225436672 400 AIGRDPDVWESPEEFSPERFLSGRNAKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKMPDGVEINM 479
225436666 401 AIGRDPDVWENPEDFAPERFLSEKHANIDPRGNDFELIPFGSGRRICSGNKMAVIAIEYILATLVHSFDWKLPDGVELNM 480
225441222 403 AIGRDPEVWENPLEFKPERFLSEKNARISPWGNDFELLPFGAGRRMCAGIRMGIEVVTYALGTLVHSFDWKLPKGDELNM 482
224105985 477 DEVFGLALQKAVPLSAMVTPRLEPNAYLA 505
224105987 481 DEVFGLALQKAVPLSAMVTPRLEPNAYLA 509
224055291 480 DEVFGLALQKAVPLSAMVSPRLEPNAYLA 508
225466541 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
225467596 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
225467598 485 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 513
225469434 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
225469436 485 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 513
225436670 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
225436672 480 DEAFGLALQKAVSLSAMVTPRLHQSAYAV 508
225436666 481 DEGFGLTLQKAVPLLAMVTPRLELSAYAA 509
225441222 483 DEAFGLVLQKAVPLSAMVTPRLHPSAYKA 511
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap