Conserved Protein Domain Family
PLN00108

?
PLN00108: PLN00108 
unknown protein; Provisional
Statistics
?
PSSM-Id: 177724
View PSSM: PLN00108
Aligned: 2 rows
Threshold Bit Score: 511.921
Threshold Setting Gi: 297830208
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30683966    1 MENLnhkWDRCSSSHQTPLSFKGNQKQIGQGQREVFTHFVSLPLAIYPDLTKNIEAFQNSVLGNNDKDPLKFQSTLAEMG 80 
297830208   1 MENL---WNRCSSSHQTPLAFKGNQKQIGQAHREVFTHFVSLPLAIYPELKKNIEAFQNSVLGNNDKNPLTFQTTLAEMG 77 
30683966   81 IEKSIFVTPKTFHLTVVMLKLENNESVVKAQNILQSIFSNVRQALKNRPVFIRLRGLECMSGSLDKTRVLYAPVEEVGRE 160
297830208  78 IEKSIFVSPKTFHLTVVMLKLENNESVVKAQNILKSICSNVRQALKDRPVFIRLRGLDCMNGSLDKTRVLYVPVEEVGHE 157
30683966  161 GRLLNACHVIIDAFENVGFAGKDAKSRLKLHATLMNASYRKDKSKKMDTFDAREIHKEFENKDWGTYLIREAHISQRYKY 240
297830208 158 GRLLNACHVIIDAFENAGFAGKDAKSRLKLHATVMNASYRKDKSKKMDTFDAREIHKEFENKDWGTYLIREAHISQRYKY 237
30683966  241 DPNGYFHCCASLPFPHK 257
297830208 238 DPNGYFHCCASLPFPHK 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap