Conserved Protein Domain Family
PLN00107

?
PLN00107: PLN00107 
FAD-dependent oxidoreductase; Provisional
Statistics
?
PSSM-Id: 165679
View PSSM: PLN00107
Aligned: 2 rows
Threshold Bit Score: 522.617
Threshold Setting Gi: 115443917
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115443917  33 IARLAAGNYGVTRRGVLppPPGAAVVGYQNRIQSSGSCLSGADDGLLTACTWDPRVRhNSFFFQSGISVPLSGAAAFIRD 112
15241228    1 MKRSMRSHLAKQTRSVI--FTGYPVIGSQDRIMSSGACLDSHQNGLITSCPWDPRIK-GEFFYQTALSVPLTHVKDFIND 77 
115443917 113 VQRLRDLNPDALCGLEVYYGVLLRYVRASTAHLGKPEDSVELDLTYYRSR-DPAAPRLHEDAVEEIEQMALRKYGGVPHW 191
15241228   78 IKALVKIEPKSLCGLELNYGVLVRYVTSSPAYLRKEEKALDFDLTYYRSKdDPWTPRLYEDYMEEIEQMAILKYNALPHW 157
115443917 192 GKNRNAAFDGAIAKYPKSGEFLKVKGSYDPEGLFSSEWSDKVLGVagAGGVSVVRDGCALEGLCVCSEDAHCSPEKGYLC 271
15241228  158 GKNRNLAFDGAIKKYKNANTFLKVKERLDPWGLFSTEWTDQILGL--KGNVTIVKQGCAPEGLCICSDDSHCAPNKGYMC 235
115443917 272 RPGRVYKEARVCRRVAG 288
15241228  236 RPGKVYKEARVCTLVTA 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap