Conserved Protein Domain Family
PLN00103

?
PLN00103: PLN00103 
isocitrate dehydrogenase (NADP+); Provisional
Statistics
?
PSSM-Id: 177720
View PSSM: PLN00103
Aligned: 22 rows
Threshold Bit Score: 839.491
Threshold Setting Gi: 224055537
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168052755   1 MAFAKIHVANPIVEMDGDEMTRIIWKMIKDKLIFPFLDLDLKYFDLGIEHRDATDDRVTIESAEATKKYNVAVKCATITP 80 
15221788    1 MEFEKIKVINPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDFTDDKVTIETAEATLKYNVAIKCATITP 80 
115435650   1 MAFEKIVVANPVVEMDGDEMTRVIWKWIKDKLIFPFLDLDIKYYDLGLPNRDATGDKVTIESAEATLKYNVAIKCATITP 80 
168052303   1 MALEKIKVENPIVEMDGDEMTRIIWQMIKEKLILPYVDVELKYYDLGILNRDATNDRVTHESAEATLKYNVAVKCATITP 80 
224101287   1 MAFDKIKVTNPIVEMDGDEMTRVIWKSIKDKLIFPFLDLDIKYFDLGLPNRDATDDRVTIESAEATLKYNVAIKCATITP 80 
224055537   1 --------------MDGDEMARIIWKMIKDKLIYPYLDLDIKYFDLGILNRDATDDKVTVESALAALEYNVAVKCATITP 66 
255572548   1 MELDKIKVDNPIVEMDGDEMTRIIWKSIKTKLIFPFLDLDIKYFDLGLPNRDATDDQVTVESAEATLKYNVAIKCATITP 80 
297848004   1 MEFEKIKVINPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDLTDDKVTIESAEATLKYHVAIKCATITP 80 
302772643   1 MAFEKIKVENPIVEMDGDEMTRIIWQMIKDKLIFPFLDLDIKYFDLGLPHRDETDDKVTVESAEATLKYNVAIKCATITP 80 
302799178   1 MAFEKIKVENPIVEMDGDEMTRIIWQMIKDKLIFPFLDLDIKYFDLGLPRRDETDDKVTVESAEATLKYNVAIKCATITP 80 
168052755  81 DEARVKEYNLKSMWRSPNGTIRNILNGTVFREPILCKNIPKLVPGWTSPICIGRHAFGDQYKATDAVFKGPGKLKMVFVP 160
15221788   81 DEARVREFGLKKMWRSPNGTIRNILNGTVFREPIICRNIPRLVPGWTKPICIGRHAFGDQYRATDLIVNEPGKLKLVFEP 160
115435650  81 DEGRVKEFNLSAMWKSPNGTIRNILNGTVFREPIICKNIPRLVPGWIKPICIGRHAFGDQYRATDTVIKGPGKLKLVF-- 158
168052303  81 DEGRVKEFGLKQMWRSPNGTIRNVLDGTVFREPILCKNIPRLVPGWTKPICIGRHAYGDQYKATDAVFKGPGKLKMVFEP 160
224101287  81 DEGRVKEFNLKNMWKSPNGTIRNILNGTVFREPIICKNIPRLVSGWTMPICIGRHAFGDQYRATDTVIQGPGKLKLVFVP 160
224055537  67 DEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILCRNIPRIVPGWKKPICIGRHAFGDQYCATDTIIPGPGKLKMVFVP 146
255572548  81 DETRVKEFNLKRMWKTPNGTIRNILNGTVFREPIICKNVPRLVPGWTKPICIGRHAFGDQYRATDAIIQGPGKLKLVFVP 160
297848004  81 DEARVKEFGLKKMWRSPNGTIRNILNGTVFREPIICRNIPRIVPGWTKPICIGRHAFGDQYRATDIIVNEPGKLKLVFEP 160
302772643  81 DEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIVCKNVPRLVPGWTKPICIGRHAFGDQYRATDTVIKGSGKLKLVFVP 160
302799178  81 DEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIVCKNVPRLVPGWTKPICIGRHAFGDQYRATDTVIKGSGKLKLVFVP 160
168052755 161 ENGGETQDLTVYDFEGaGGVALTMYNTDESIRSFAESSMAMAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEQEgWKA 240
15221788  161 SGSSQKTEFEVFNFTG-GGVALAMYNTDESIRAFAESSMYTAYQKKWPLYLSTKNTILKIYDGRFKDIFQEVYEAN-WRS 238
115435650 159 DGREEQIELDVFNFTGaGGVALSMYNTDESIWAFAEASMNMAYQKRWPLYLSTKNTILKKYDGRFKDIFQENYETK-WRA 237
168052303 161 DNGGEPIDLDVYHYNGaGGVALCMYNTDESIRGFAKASFTMAMQKKWPLYLSTKNTILKKYDGRFKDIFQEVFVNEgWEA 240
224101287 161 DGQSEKTEFEVFKFKGaGGVALSMYNTDESIHAFAEASMNTAYLKKWPLYLSTKNTILKKYDGRFKDIFQEVYEMQ-WKS 239
224055537 147 EDGEVPVELDVYNFKG-PGIALAMYNVDESIRNFAESSMSLAFAKKWPLYLSTKNTILKKYDGRFKDIFQEVYEEK-WKQ 224
255572548 161 GGRDEKTEFEVFKFTGaGGVALSMYNTEESIHAFAEASMSTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYETR-WKS 239
297848004 161 SGSSQKTEFEVFNFTG-GGVALAMYNTDESIRAFAESSMYTAYQKKWPLYLSTKNTILKTYDGRFKDIFQEVYEAN-WRS 238
302772643 161 E-NGEASEFEVYDFKGdGGVALSMYNTDESIRSFAQASMTTALAKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAE-WKS 238
302799178 161 E-NGEASEFEVYDFKGdGGVALSMYNTDESIRSFAQASMTTALAKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAE-WKS 238
168052755 241 KFDAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDMLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYR 320
15221788  239 KYEAAGIWYEHRLIDDMVAYAMKSEGGYVWACKNYDGDVQSDFLAQGYGSLGMMTSVLVCPDGKTIEAEAAHGTVTRHYR 318
115435650 238 KFDDAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDLIAQGFGSLGLMTSVLVCPDGRTIEAEAAHGTVTRHYR 317
168052303 241 KFKDAGIWYEHRLIDDMVAYALKSEGEYVWACKNYDGDVQSDMLAQGFGSLGLMTSVLICPDGKTIEAEAAHGTVTRHFR 320
224101287 240 KFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYR 319
224055537 225 KFEENSIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVLSDLLAQGFGSLGLMTSVLLSSDGKTIEAEAAHGTVTRHFR 304
255572548 240 KFQAAGIWYEHRLIDDMVAYAIKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGRTIEAEAAHGTVTRHYR 319
297848004 239 KYEAAGIWYEHRLIDDMVAYAMKSEGGYVWACKNYDGDVQSDFLAQGYGSLGMMTSVLVCPDGKTIEAEAAHGTVTRHYR 318
302772643 239 KFEEAGIWYEHRLIDDMVAYALKSDGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYR 318
302799178 239 KFEEAGIWYEHRLIDDMVAYALKSDGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYR 318
168052755 321 VHQKGGETSTNSIASIFAWTRGLSHRGKLDGNEKLVDFATKLEQACVGTVENGKMTKDLALLIHGSKLSRDTYLNTEEFI 400
15221788  319 VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNAALLSYTEKLEAACMGTVESGKMTKDLALLIHGAKVRRDQYVNTEEFI 398
115435650 318 VHQKGGETSTNSIASIFAWTTGLGHRAKLDDNKRLLDFVQKLEAACVGTVESGKMTKDLALLVHGPNVSRDKYLNTVEFI 397
168052303 321 VHQKGGETSTNSIASIFAWTRGLGHRALLDGNAKLQEFAQSLEAACIATVESGKMTKDLALLSHGPNVSRNNYLNTEEFI 400
224101287 320 VHQKGGETSTNSIASIFAWSRGLAHRAKLDGNVRLSDFTAKLEASCIGAVESGKMTKDLALLIHGPRVSRGRYLNTEEFI 399
224055537 305 LYQKGQETSTNSIASIFAWTRGLEHRAKLDNNERLLDFALKLEASCIGTVEAGEMTKDLAILTHGPRVSREFYLNTEEFI 384
255572548 320 VHQRGGETSTNSIASIFAWSRGLAHRAKLDGNARLLEFTEKLEAACVGAVESGKMTKDLALLIHGPKVTRAQYLNTEEFI 399
297848004 319 VHQKGGETSTNSIASIFAWSRGLAHRAKLDSNAALLSYTEKLEAACMGTVESGKMTKDLALLIHGPKVRRDQYVNTEEFI 398
302772643 319 VHQKGGETSTNSIASIFAWSRGLSHRASLDGNARLSDYAEKLEAACVGIVESGKMTKDLALLIHGPKVTKKDYLNTEEFI 398
302799178 319 VHQKGGETSTNSIASIFAWSRGLSHRATLDGNARLSDYAEKLEAACVGIVESGKMTKDLALLIHGPKVTKKDYLNTEEFI 398
168052755 401 DAVAEELKSKL 411
15221788  399 DAVAWELKRRL 409
115435650 398 DAVAEDLRTRL 408
168052303 401 DAVADELISRL 411
224101287 400 DAVAEELKARL 410
224055537 385 DAVARNLETKL 395
255572548 400 DAVAEELRLRL 410
297848004 399 DAVAWELRRRL 409
302772643 399 DAVAADLKLRL 409
302799178 399 DAVAADLKLRL 409
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap