Conserved Protein Domain Family
PLN00099

?
PLN00099: PLN00099 
light-harvesting complex IChlorophyll A-B binding protein Lhca1; Provisional
Statistics
?
PSSM-Id: 177717
View PSSM: PLN00099
Aligned: 6 rows
Threshold Bit Score: 490.694
Threshold Setting Gi: 15233115
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225449078   1 MASTVLRSCGVAAVAPSLLSSSKSKFATS-LPLPNAAAgSARVTMSADWMPGQPRPPYLDGSAPGDFGFDPLRLGEVPEN 79 
224100797   2 AATNTLMSCGIATAFPSLLSSSKSKFASS-IPLPSVNG-TSRVTMSADWLPGQPRPPYLDGSAPGDFGFDPLRLGEVPEN 79 
224109746   1 MATNTLMSCGIATAFPSLLSSSKSKFASS-IPLPSVNG-TSRVTMSANWMPGQPRPPYLDGSAPGDFGFDPLRLGEVPEN 78 
255585090   1 MATNTLMSCGIATAFPSLLSSSKSKFASS-VPLPCVNGsSSRITMSADWMPGQPRPPYLDGSAPGDFGFDPLRLGEVPEN 79 
15233115    1 MASNSLMSCGIAAVYPSLLSSSKSKFVSAgVPLPNAGN-VGRIRMAAHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPAN 79 
297820242   1 MASNSLMSCGIAAVYPSLLSSSKSKFVSAgVPLPNAGN-VGRIRMAAHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPEN 79 
225449078  80 LERYKESELIHCRWAMLAVPGVLVPEALGLGNWVQAQEWAAIPGGQATYLGNPVPWGNLPTILAIEFLAIAFVEHQRSME 159
224100797  80 LERYKESELIHCRWAMLAVPGILIPEALGLGNWVKAQEWAAAPGGQATYLGQPVPWGTLPTVLAIEFVAIAFVEHQRSME 159
224109746  79 LERYKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAATPGGQATYLGQPVPWGTLPIILAIEFVAIAFVEHQRSME 158
255585090  80 LERFKESELIHCRWAMLAVPGILVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILVIEFLAIAFVEHQRSME 159
15233115   80 LERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSME 159
297820242  80 LERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAAVPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSME 159
225449078 160 KDTEKKKYPGGAFDPLGYSKDPVKFEEYKVKEIKNGRLAILAFVGFCVQQSAYPGTGPLENLASHLADPWHNNIGDVIIP 239
224100797 160 KDPEKKKYPGGAFDPLGFSKDPKKFEEYKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIIVP 239
224109746 159 KDTEKKKYPGGAFDPLGYSKDPQKFEEYKVKEIKNGRLALLAFVGICVQQTAYPGTGPLENLATHLADPWHNNIGDVLIP 238
255585090 160 KDPEKKKYPGGAFDPLGYSKDPAKFHEYKVKEIKNGRLALLAFVGICVQQSAYPGTGPLENLATHLADPWHNNIGDIIIP 239
15233115  160 KDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIP 239
297820242 160 KDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDIVIP 239
225449078 240 RSIMP 244
224100797 240 RTLSP 244
224109746 239 RSVSP 243
255585090 240 TSFSP 244
15233115  240 FN--- 241
297820242 240 FN--- 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap