Conserved Protein Domain Family
PLN00098

?
PLN00098: PLN00098 
light-harvesting complex I chlorophyll a/b-binding protein (Lhac); Provisional
Statistics
?
PSSM-Id: 177716
View PSSM: PLN00098
Aligned: 6 rows
Threshold Bit Score: 489.038
Threshold Setting Gi: 297844880
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15221956    1 MAFAIASALTSTLTLSTSrvqnPTQRRPHVASTSSTGGRLmRERLVVVRAGkeVSSVCEPLPPDRPLWFPGSSPPEWLDG 80 
115479363   1 MALPSGSFAACSIQPRVR----AALRAPTLPSQNAAVARMaGHRAGATKGG--VSAVCEPLGPDRPLWFPGSSPPPWLDG 74 
224069184   1 MALNFASSSLSSLPTRTRdkpqKSLLGKIEKCQAV------KVRVNATK-G--VSSVCEPLPPDRPLWFPGSSPPEWLDG 71 
225444667   1 MALSIASTAFSSL--PTRevssKHFPRKLTTWLPG------RVRLNATK-G--VSSVCEPLPPDRPLWFPGSSPPEWLDG 69 
255550389  34 MALTIASSSLSSLLSSTReipqKAFIRKIGTCQVGKA----KVKLNATKGG--VSTVCEPLPPDRPLWFPGSSPPEWLDG 107
297844880   1 MAFAIASALTSTLTLSTSrvqnATQRRPLVASASPTGGRM-SERLVVARAGkeVSSVCEPLPPDRPLWFPGSAPPEWLDG 79 
15221956   81 SLPGDFGFDPLGLGSDPDTLKWFAQAELIHSRWAMLAVTGIIIPECLERLGFIENFSWYDAGSREYFADSTTLFVAQMVL 160
115479363  75 SLPGDFGFDPLGLGSDPELLRWFAQAELMHSRWAMLAVAGILVPEVLEKWGFMEDYSWIDAGARDYFADPWTLFVSQMAL 154
224069184  72 SLPGDFGFDPLGLGSDPESLKWFAQAELIHGRWAMLAAAGILIPEWLERLGFIDNFNWFDAGTREYFADPTTLFVVQLIL 151
225444667  70 SLPGDFGFDPLGLGSDPELLRWFAQAELMHSRWAMLAVAGILIPECLERLGFIENFSWYDAGAQEFFADPTTLFVVQLAL 149
255550389 108 SLPGDFGFDPLGLGSDPELLKWFAQAELMHSRWAMLAVAGILIPEWLESLGFIENYNWFDAGAREYFADPTTLFIVQLVL 187
297844880  80 SLPGDFGFDPLGLGSDPDTLKWFAQAELIHSRWAMLAVTGILIPECLERLGFIENFSWYEAGSREYFADSTTLFVAQMVL 159
15221956  161 MGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFLGFCFQA 240
115479363 155 MGWAEGRRWADYLNPGCVAVEPRLPNRRNPVPDVGYPGGLWFDWGNWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFWFQA 234
224069184 152 MGWIEGRRWADMIKPGCVDIDPKLPHKTKPKPDVGYPGGLWFDPWNWGRGSPEPVMAIRTKEIKNGRLAMLAFVGFWFQA 231
225444667 150 MGWVEGRRWADLINPGCVDIQLTFPNKAKPKPDVGYPGGLWFDPFMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQA 229
255550389 188 MGWVEGRRWADMIKPGCVDIEPTLPNKTKPKPDVGYPGGLWFDPLMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQA 267
297844880 160 MGWAEGRRWADLIKPGSVDIEPKYPHKVNPKPDVGYPGGLWFDFMMWGRGSPEPVMVLRTKEIKNGRLAMLAFVGFCFQA 239
15221956  241 TYTSQDPIENLMAHLADPGHCNVFSAFTSH 270
115479363 235 VYTGEGPIDNLLHHLADPGHCNVFSAFTSH 264
224069184 232 IYTGEGPIDNLMAHIADPGHCNIFSAFTSH 261
225444667 230 IYTGEGPIENLMAHIADPGHCNVFSAFTSQ 259
255550389 268 VYTGEGPIENLMAHIADPGHCNIFSAFTSQ 297
297844880 240 TYTSQDPIENLMAHLADPGHCNVFSAFTSH 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap