Conserved Protein Domain Family
PLN00097

?
PLN00097: PLN00097 
photosystem I light harvesting complex Lhca2/4, chlorophyll a/b binding; Provisional
Statistics
?
PSSM-Id: 165670
View PSSM: PLN00097
Aligned: 2 rows
Threshold Bit Score: 468.718
Threshold Setting Gi: 145350546
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255085312   1 MASIVAQQLAAGLTQKsrtvrprgVASKARASVRVGAVAAA--RPTWLPGSPAPAHLDGTLPCDYGFDPLNLGADPENLK 78 
145350546   1 MSVSMRISSTAGLKTR--------VATKTRASRGPVAVSANadRPVWYPGKAPAAHLDGSLPGDYGFDPLSLSADPEMRQ 72 
255085312  79 WFVQAELMHCRWAMLGLAGMVGPELLTKIGMADLPNWIDAGKWDgYWLGAGPLFFVQMAMMNWAEVRRWQDMKAPGTMNE 158
145350546  73 WMVQAELQHARWAMLGVAGCVAPELLTKIGVADLPNWVDAATYQ-YWAPGGTLFFIQMAMFNWAEIRRWQDMKNPGSVNT 151
255085312 159 DPLTGANKGDTNTDVGYPKGLFDPMGYAKDPKKAEELKRKEIANGRLAMVAIVGCFAQAISTGTGPVDNLFTHLADPGHN 238
145350546 152 DPLFGYNSNDTNTDVGYPKGLFDKFGWAKDEKTTAELKLKEIKNGRLAMLAFLGICAQYVQTGVGPVENLFSHMGNPGQV 231
255085312 239 NIFG 242
145350546 232 GVFM 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap