Conserved Protein Domain Family
PLN00096

?
PLN00096: PLN00096 
isocitrate dehydrogenase (NADP+); Provisional
Statistics
?
PSSM-Id: 177715
View PSSM: PLN00096
Aligned: 4 rows
Threshold Bit Score: 821.201
Threshold Setting Gi: 145353749
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145353749   1 MVYVRGEEMTAYVMDLIRAKWIEPRVDTTAWREFDLRAKNRDDTEDQVLRDVIEAGKAVKAIFKEPTVTPTADQVKRLGL 80 
145357157  13 MVYVRGEEMTAYVMDLIRAKWIEPRVDTTAWREFDLRAKNRDDTEDQVLRDVIEAGKAVKAIFKEPTVTPTADQVKRLGL 92 
255077633  15 MVYVAGEEMTRYTMDLILERWIKPHVDTSAWEFFDLRAKNRDDTEDQVLRDVISAGARLKAIFKEPTITPTADQVKRLGL 94 
303275390   1 MVYVAGEEMTRYTMQLILDKWVSPHVDTSRWEFFDLRAKNRDDTEDQVLRDVITAGARLKAIFKEPTITPTADQVKRLGL 80 
145353749  81 RKSWGSPNGAMRRGWNGITISRDTIHIDGVELGYKKPVFFERHAVGGEYAAGYKNVGKGTLVTTFTPSEGpdaGKPVEVD 160
145357157  93 RKSWGSPNGAMRRGWNGITISRDTIHIDGVELGYKKPVFFERHAVGGEYAAGYKNVGKGTLVTTFTPSEGpdaGKPVEVD 172
255077633  95 KKAWGSPNGAMRRGWNGITISRDTIHIDGVELGYKKPVFFERHAVGGEYSAGYKIVGKGKLTTTFVPEAG---GEPIVVD 171
303275390  81 KKAWGSPNGAMRRGWNGITISRDTIHIDGVELGYKKPVFFERHAVGGEYSAGYKIVGKGQLKTTFVPEGG---GDAIVVD 157
145353749 161 SRTITDNEAAVVTYHNPYDNVHELARFFFGRCLEAKITPYVVTKKTVFKWQEPFWQIMKKVFDEEYKSKFVDAGVMKSGD 240
145357157 173 SRTITDNEAAVVTYHNPYDNVHELARFFFGRCLEAKITPYVVTKKTVFKWQEPFWQIMKKVFDEEYKSKFVDAGVMKSGD 252
255077633 172 DRKITDDLNAVVAYHNPLDNVAHLARIFFGRCLDAGIVPYVVTKKTVFKWQEPFWESMKTVFDAEFKQKFYEKGVMKPGS 251
303275390 158 DRAVVDDLNAVVTYHNPLDNVNHLARIFFGRCLDAGIVPYVVTKKTVFKWQEPFWETMKRVFDDEFKEKFRAKKIIGDNA 237
145353749 241 ELVHLLSDAATMKLVQWRQGGFGMAAHNYDGDVLTDELAQIHKSPGFITSNLVGVDENGTLIKEFEASHGTVADMDEARL 320
145357157 253 ELVHLLSDAATMKLVQWRQGGFGMAAHNYDGDVLTDELAQIHKSPGFITSNLVGVDENGTLIKEFEASHGTVADMDEARL 332
255077633 252 ELVHLLSDAATMKLVVWTDGGFGMAAHNYDGDVLTDELAQVHKSPGFITSNLVGVDDNGTLIKEFEASHGTVTDMDEARL 331
303275390 238 ELVHLLSDAATMKLVVWTDGGFGMAAHNYDGDVLTDELAQVHMSPGFITSNLVGVDADGTLIKEFEASHGTVTDMDEARL 317
145353749 321 RGEETSLNPLGMVEGLIGAMNHAADVHNvDKERTLAFTAKMRAVIHQLFREGKGTRDLSGPSGLTTEQFVDAVAERL 397
145357157 333 RGEETSLNPLGMVEGLIGAMNHAADVHNvDKERTLAFTAKMRAVIHQLFREGKGTRDLSGPSGLTTEQFVDAVAERL 409
255077633 332 RGEETSLNPLGMVEGLIGAMNHAADVHG-GSSGVHPWTGKLRAVIHKLFREGRGTRDLCGAGGLTTEQFIDAVAEEL 407
303275390 318 RGEETSLNPLGMVEGLIGAMNHAADVHG-GADAVHPYTAKLRAVIHKLFREGRGTRDLCGAGGLTTEQFIDAVAAEL 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap