Conserved Protein Domain Family
PLN00093

?
PLN00093: PLN00093 
geranylgeranyl diphosphate reductase; Provisional
Statistics
?
PSSM-Id: 177713
View PSSM: PLN00093
Aligned: 25 rows
Threshold Bit Score: 736.946
Threshold Setting Gi: 115435818
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219109757   1 MKFTLALTTLTSVSAFTASSFVGQNLASVPVSKS--ALDMKYKVAVVGGGPAGACAAEIFAQEkGIDTVLFERKLDNAKP 78 
145342134  12 ERSLSAKLHEPKLSRSRTTARVTPRNVVTASGAP--LTDRKLRVAVIGGGPAGACAAETLAKG-GCETFLIERKMDNCKP 88 
115435818   1 ---------MAAAVAAAACHSPARLVVTCSSSATpaPPRRPLRVAVVGGGPAGASAAEALASA-GAQAFLLERNPSGAKP 70 
224010635   1 ---------------------------------------MKYKVAVVGGGPSGACAAEIFAQEkGIDTVMFERKMDNAKP 41 
224132246   6 LTHNLLFAPTPPLKTLKPHQKPKPHNLTITATS---ISGRKLRAAVIGGGPAGSSAAEALAAG-GVETFLFERSPSTAKP 81 
224102913   6 LTHNLHFTPTLPLKAIKQHQQPKPKTLTITATSSspLSGRKLRAAVIGGGPAGSSAAEALAAG-GVETFLFERSPSTAKP 84 
242052533   1 -----------MAAACYYPARIMISCSATTTTTSssPSARPLRVAVVGGGPAGASAAEALASA-GARTFLLERSPAGAKP 68 
224147708   6 LTHNLLFAPTPPLKTLKPHQKPKPHNLTITATS---ISGRKLRAAVIGGGPAGSSAAEALAAG-GVETFLFERSPSTAKP 81 
255083236  17 TSLRNSKFHGAKVAPMRAVKAAAVDTGIKAAGKS--LDGRKLRVAVIGGGPAGACAAETLAKG-GCETFLIERKMDNCKP 93 
255561256   8 HHLYSTFLCPLYTPTSKSTFFKPQTLSITSA-----ISGRKLRAAVIGGGPAGSSAAEALAAG-GIETFLFERSTSTAKP 81 
219109757  79 CGGAIPLCMVGEFDLPESVVDRKVRRMNLISPKGVEVDIG-ETLKPDEYIGMTRREILDGYLRDRAIDYGAEIVNGLVTS 157
145342134  89 CGGAIPLCMVGEFDLPEEIIDRKVTKMKMISPSNRAVDVG-QTLNDKEYIGMCRREVMDDFLRKRAKSLGANLVNGLFMK 167
115435818  71 CGGAIPLCMLDEFAIPRDLVDRRVTRMRVLSPSNLAADFS-RALPPGAHIPMLRREVLDSFLRRRAADAGATLVPGLVTS 149
224010635  42 CGGAIPLCMIGEFDIPESTVDRKVRRMKLISPSNNEVDIG-DTLQPNEYIGMCRREIMDKYLRDRAISYGAEPINGLVTA 120
224132246  82 CGGAIPLCMIDEFSIPLHLVDRHVTRMKIISPSNLTVDFGsRTLKSHEFIPMLRREVLDSFLRSRAQSNGAHFITGLVTD 161
224102913  85 CGGAIPLCMIDEFSIPLHLIDRHVTRMKIISPSNLTVDFGsKTLKSHEFIPMLRREVLDSFLRSRAQSNGAQFITGLVTD 164
242052533  69 CGGAIPLCMLDEFAIPRDLVDRRVTRMRVVSPSNLAADFS-RALPPGAHIPMLRREVLDSFLRRRAAEAGAELVPGLVTS 147
224147708  82 CGGAIPLCMIDEFSIPLHLVDRHVTRMKIISPSNLTVDFGsRTLKSHEFIPMLRREVLDSFLRSRAQSNGAHFITGLVTD 161
255083236  94 CGGAIPLCMVGEFDLPEEIIDRKVTKMKMISPSNRAVDVG-QTLNDKEYIGMCRREVMDDFLRKRAKSLGTNLVNGLFMK 172
255561256  82 CGGAIPLCMLDEFNIPLNLIDRHVTRMKIVSPSNLTVDFGsKTLKPHESIPMLRREVLDSFLRSRVQSKGATLIQGLVMH 161
219109757 158 IDIPADHkvsENQYTINYQAYEEGSSAGTPKNMKVDLIVGADGANSRVAKAMDAGQYNFAIAFQERIKIPDDKMKFYEEM 237
145342134 168 IEDPGQG---NGPIMVQYNDYEEESKTGVPKTLEVDVVIGADGANSRVAKCIDAGEYDYAIAFQERIKIPDAKMEYYKDL 244
115435818 150 LSLPADPa--TDPYLVHYISSDSGGPSSSRCVLEVDAVIGADGANSRVAREVGAGDYSTAIAFQERIRLPDEAMAYYDDL 227
224010635 121 IDVPEDHkttEKQYTLHYQEFQAGSSAGVPKSMNVDLIIGADGANSRVAKAMDAGEYNFAIAFQERIKITDEQMSFYEEM 200
224132246 162 IEVPDFFs--SKPYVIHHTIN------NRKQSLAVDLIVGADGANSRVAKIIDAGNYSCAIAFQERIKLPDEKMEYYHDL 233
224102913 165 IEVPDFLs--SKPYVIHHTIN------NCKRSLAVDLIVGADGANSRVAKIINAGNYRCAIAFQERIKLPDEKMEYYHNL 236
242052533 148 LSLPAGP---ADPYLVHYISSSSPEG-AGRGVLEVDAIVGADGANSRVAREVGAGDYTTAIAFQERIRLPDAAMGYYDDL 223
224147708 162 IEVPDFFs--SKPYVIHHTIN------NRKQSLAVDLIVGADGANSRVAKIIDAGNYSCAIAFQERIKLPDEKMEYYHDL 233
255083236 173 LDDPGQG---NGPITIHYNDYEADAKVGEPKTMEVDVVIGADGANSRVAKNIDAGEYDYAIAFQERIKIPDEKMDYYKDL 249
255561256 162 IDIPSLP---KEPYIIHHIINN-----NIKGELAVDVVIGADGANSRVAKSINAGNYSCAIAFQERIRLPDDKMEYYKDL 233
219109757 238 AEMYVGDDVSPDFYGWVFPKYDHVGVGTGTVVNRPAIKQYQKAIRDRAGDKIAGGKIIKVEAHPIPEHYRPRRVQGRIAL 317
145342134 245 AEMYVGDDVSPDFYGWVFPKYDHVAVGTGTVVNKTAIKQYQTAMRNRAEEKCEGGKIIRVEAHPIPEHPRPNRVKGRVAL 324
115435818 228 AEMYVGGDVSPDFYGWVFPKCDHVAVGTGTVAAKPEIKRLQSGIRARAAGKVAGGRVVRVEAHPIPEHPRPRRVVGRVAL 307
224010635 201 AEMYVGDDVSPDFYGWVFPKYDHVGVGTGTVVNRPAIKQYQKAMRDRAGDKIAGGKIIKVEAHPIPEHYRPNRVQGRMAL 280
224132246 234 AEMYVGNDVSPDFYAWVFPKCDHVAVGTGTVCARQNIKVYQRGIRERVREKIKGGKVIKVEAHPIPEHPRPRRVRGRVAL 313
224102913 237 AEMYVGNDVSPDFYAWVFPKCDHVAVGTGTACARRDIKVYQRGIRERVKEKIKGGRVIKVEAHPIPEQPRPRRVRGRVAL 316
242052533 224 AEMYVGGDVSPDFYGWVFPKCDHVAVGTGTVAAKPEIKRLQSGIRARAGPKIAGGRVVKVEAHPIPEHPRPRRVVGRVAL 303
224147708 234 AEMYVGNDVSPDFYAWVFPKCDHVAVGTGTVCARQNIKVYQRGIRERVREKIKGGKVIKVEAHPIPEHPRPRRVRGRVAL 313
255083236 250 AEMYVGDDVSPDFYGWVFPKYDHVAVGTGTVVNKTAIKQYQAAMRKRAEEKCAGGKIIRVEAHPIPEHPRPRRVQGRVTL 329
255561256 234 AEMYVGDDVSPDFYAWVFPKCDHVAVGTGTVCSKQNIKVFQRGIRERVRDKIKGGKVIKVEAHPIPEHPRPTRVRGRVAL 313
219109757 318 VGDAAGYVTKCSGEGIYFAAKSGRMAAEEIVKLMKNGSVLPTQADIeRTYLKKYDNLYGPTYTVLDLLQKVFYVNNGARE 397
145342134 325 VGDAAGYVTKCSGEGIYFAAKSGRMAAEAVVEQSMNGTKEIGETDL-RVYLDKWDRKYWATYKVLDILQKVFYRSNPARE 403
115435818 308 VGDAAGYVTRCSGEGIYFAARSGRLCGRAMADEWRL-TGAVTEAGIrAGYLRRWDDEFRPTFRFLDLLQRVFYGGNAGRE 386
224010635 281 VGDAAGYVTKCSGEGIYFAAKSGRMAAEAIVKLMDGGKRLPTQNEIeRTYLADYDKLYGPTYTVLDILQKVFYSNNGARE 360
224132246 314 VGDAAGYVTKCSGEGIYFAAKSGRMCGEAIVKASEGGEKMISEEDLkREYLREWDRKYVNTFRFLDLLQKVFYGSDVGRE 393
224102913 317 VGDAAGYVTKCSGEGIYFAAKSGRMCGEAIVKASEGGERMVSEEDLrREYLREWDNKYVNTFRFLDLLQRVFYGSNVGRE 396
242052533 304 VGDAAGYVTRCSGEGIYFAAKSGRLCGQAMAEEWAR-TGAVTEAGLrRGYLRRWDDEFLLMFRFLDLLQRVFYGGNAGRE 382
224147708 314 VGDAAGYVTKCSGEGIYFAAKSGRMCGEAIVKASEGGEKMISEEDLkREYLREWDRKYVNTFRFLDLLQKVFYGSDVGRE 393
255083236 330 VGDAAGYVTKCSGEGIYFAAKSGRMAAEAVVERSQNGTKEVDESDL-RVYLDKWDRKYWATYKVLDILQKVFYRSNPARE 408
255561256 314 VGDAAGYVTKCSGEGIYFAAKSGRMCGEGIVKASEGGEKMVSEEDLkREYLREWDNKYVNTFRFLDLLQRVFYGSNVGRE 393
219109757 398 AFVELCNSKYVQQVTFDSYLYKRVQGNNPLDDLKLLGETIGCLIKGYADAKPDAEFSN 455
145342134 404 AFVEMCADEYVQKMTFDSYLYKTVVPGNPLDDAKLLANTVASLMRSNALRIASKSGIA 461
115435818 387 ALVEMCADEHVQRRTFDSYLHKRMAPAEPWGDLRLLWRTAAAMVRCGVLGREVERLRR 444
224010635 361 AFVELCNSKYVQQVTFDSYLYKKVQGNNPLDDIKLLGETIGCLIKGYSIAKPDAEFSN 418
224132246 394 ALVELCGDEYVQRMTFDSYLYKKLATGDRWGDVKLVLNTFGSLMRCKVLGREMEALKL 451
224102913 397 ALVELCGDEYVQRMTFDSYLYKKMASGDRWDDVKLVLNTFGSFMRCKVVGREMEALKL 454
242052533 383 ALVEMCADEYVQRRTFESYLYKRMVPGEPWGDLRLLWRTVASMVRCGVIGREVERLRR 440
224147708 394 ALVELCGDEYVQRMTFDSYLYKKLATGDRWGDVKLVLNTFGSLMRCKVLGREMEALKL 451
255083236 409 AFVEMCADEYVQKMTFDSYLYKTVVPGNPLDDAKLLGNTIASIVRANALRAAGKAQVN 466
255561256 394 ALVELCGDEYVQRMTFDSYLYKKLAGGDRWEDVKMVLNTFGSLVRCRIVGREMEGLKV 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap