Conserved Protein Domain Family
PLN00092

?
PLN00092: PLN00092 
photosystem I reaction center subunit V (PsaG); Provisional
Statistics
?
PSSM-Id: 177712
View PSSM: PLN00092
Aligned: 8 rows
Threshold Bit Score: 188.948
Threshold Setting Gi: 225453018
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225453018   1 MATITASNPATS-LVRASVASKGLNGI-SSPVLGLPAMA-KKGRVRCMSEEKPCGSDMGSSiSMGASLMAAAAAVAASaG 77 
224062236   1 MATITASTATSS-IVRAALAHRPSVGVsSSHVLGLPAIA-KKGKVSCSMEGKPTVEEEKSK-GMSASLMAAVCAATIS-S 76 
224085585   1 MATITASTTTTSsLVRAALVHKPSLGVsCSPVLGLPAMA-KKGRVSCSMEGKPSVEEKCK--GMSASLMAAVCAASMS-S 76 
225437235   1 MASITASTPTSS-LPRVGLRPNGGTVGtSSAILGLPVMA-KKGRVTCSMKEKPSVEDGSLKmGMGASLMAAACAATMS-S 77 
255580931   1 MAAMTTSKLTTL-LPPATF---NKTRIqATPILGLPVMAtRGCRVRCSIEEKAEAKDKSLNtSMVASMVAAASAVAATaG 76 
255559939   1 MATIFASTPTSS-ITRANFVHKSSSGItTSRNLDLPAMAmKRGSVRCCMDE----QQSRSNkGMSASLIASICGVTMS-S 74 
15224531    1 MASFTASASTVS-AARPALLLKPTVAI-SAPVLGLPPMGkKKGGVRCSMETK---QGNVSVmGAGVSAAATAALTAVMsN 75 
297826473   1 MASFTASASTVS-AARPAILLKPTVAV-SAPVLGLPPMGkKKGGVRCSMETK---QGNVSAmGAGVSAAATAALTAVMsN 75 
225453018  78 PAMALVDERLSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFTYTATLEEDDESGLSL 135
224062236  77 PALALVDERMSTEGTGLPFGLSNNLLVWILLGVFAFIWSLYFVYTSSLDEDEDSGMSL 134
224085585  77 PALALVDERMSTEGTGLPFGLSNNLLVWILLGVFALIWALYFTYTATLEEDEESGLSL 134
225437235  78 PAMALVDERMSTEGTGLPFGLSNNTLGWILFGVFGLIWALYFVYTATLEEDEESGLSL 135
255580931  77 PAMALVDERMSTEGTGLPFGLSNNLLGWILLGVFALIWSLYTVYTSTLDEDDDSALSL 134
255559939  75 PALALVDERLSTEGTGLPFGLSNNLLGWILLGVFGLIWSFYTVYTSTLDDDEDSGLSL 132
15224531   76 PAMALVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEESGLSL 133
297826473  76 PAMALVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWTFFFVYTSSLEEDEESGLSL 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap