Conserved Protein Domain Family
PLN00090

?
PLN00090: PLN00090 
photosystem II reaction center M protein; Provisional
Statistics
?
PSSM-Id: 165663
View PSSM: PLN00090
Aligned: 2 rows
Threshold Bit Score: 142.942
Threshold Setting Gi: 219127825
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
223998532   1 MKSFQIVTLFAMIAATMAFAPNKAPQVAQRFAesgfdMKKAAIAAIPAAIATPAFAMDSIVEALPTQTLSLEVQFGAYLA 80 
219127825   1 MKSFQLLTLFALIAASLAFAPNQAPQQVAKAA-----FTKAAGALPVAALAAPAFALDSIVEALPTNTVALEVQFGAYLA 75 
223998532  81 VLLGTFLPVLFLINLYIQTESRKAGRDGGIDSE 113
219127825  76 VALGTLLPCLFLINLFIQTESRKAGRAGGQDAE 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap