Conserved Protein Domain Family
PLN00089

?
PLN00089: PLN00089 
fucoxanthin-chlorophyll a/c binding protein; Provisional
Statistics
?
PSSM-Id: 177710
View PSSM: PLN00089
Aligned: 2 rows
Threshold Bit Score: 327.795
Threshold Setting Gi: 219123709
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219124057   1 MKSIIFASLLTSAAAFAPASSSTTRTATPTALNEEFCRGYVGGESVEPmfigktgskNFDPLGLTEKVPEWVPWFRESEL 80 
219123709   1 MKFAILAALCASSALAFTPQKSRVTPSVSTSAAVDDMPGAINFAAKEF---------KFDPLKLAETYEPFLPWFRESEL 71 
219124057  81 KHGRAAMLAVAGFVVPEFVRVPGEAYSFAAIPNVIDAHDALPQ--AMIQIFAWISFVE-AVSFPALANMNEFDRVPGDFG 157
219123709  72 RHGRTAMLAVVGFIATDFVRIPGEAYSFAAIPKTIDAHDALLKsgPMYQLLLWIGLWDlIVTAPAAVAAAKGERTPGDFG 151
219124057 158 FDPLKlyPKDAAKQEQMQLKELKNGRLAMVAIGGMVTGSAITGHGFPYL 206
219123709 152 WTLMA--PKDDAKMQKKKDSELLNGRLAMVAVGGIATQSVITGHGFPYI 198
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap