Conserved Protein Domain Family
PLN00088

?
PLN00088: PLN00088 
predicted protein; Provisional
Statistics
?
PSSM-Id: 177709
View PSSM: PLN00088
Aligned: 3 rows
Threshold Bit Score: 102.403
Threshold Setting Gi: 168059259
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168053215   1 MACVSMAAVSSATLAPaATQVWEGKTLSRQGLSLAAASPLrmAGQVAMNRSRVVMS-----------------AAPQDKN 63 
168059259   1 MASTAVASSLSAAVAP-ATLVWEAKILSRQGLALAAPSVR--SSKLIANRSRVVMSnslssaaaeivvslgcaSPQSDNK 77 
168010797   1 MACAAMTS--AAATASlMSLGATAKLPSHKGLALATPLGKkqVSVAISNGNRVSMSl----------------PAKENHN 62 
168053215  64 VAGLTSLALLAAAVVPEIAEAAQPGISPSLKNLLLSVVAGGTVLTVIGVAVAGVSTFDPVKRK 126
168059259  78 LAALTSLAFLAAAVVPEIAEAAQPGVSPSLKNLLLSVVAGGVVVTVIGVAVAGVSTFDPVKRK 140
168010797  63 VMSLTGLALVAAAVVPEIAEAAQPGVSDSLRNLLLSVLAGGVVISVIGVAVAGVSTFDPVSRR 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap