Conserved Protein Domain Family
PLN00085

?
PLN00085: PLN00085 
photosystem II reaction center protein M (PsbM); Provisional
Statistics
?
PSSM-Id: 177708
View PSSM: PLN00085
Aligned: 2 rows
Threshold Bit Score: 174.534
Threshold Setting Gi: 255089344
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255089344  82 MSCIAAAGLIPLRAAPVRRAASAKSSKvrfpeerarshprapprtgdstrasgrvraertgaasharfrraprvlarspp 161
303287821   1 MSAIAAAGLIPLKAAPVRRSAKATSSK----------------------------------------------------- 27 
255089344 162 dramtsplianprarprlatkfspipppppsppsqtqaVVVAPRAAARTEVVAKASPQKLAASVAASFPAF-AAPAAFAA 240
303287821  28 --------------------------------------AVVAPRAALRQGVVAKASPKNVLASVSAAFPAFaAAPAAFAA 69 
255089344 241 QEVNQVALEGVNILGVIATALFIIIPTSFLIILYVKSASEGNVSGGFSQKYYDESKKRGDKKTNEAAVLKGKGLGMRPSK 320
303287821  70 EELNQVALADVNILGVIATALFIIIPTSFLIILYVKSASEGNVSGGFSQKYYDDSKKRGDKKTNEAAIVKGKGLGMRPEK 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap