Conserved Protein Domain Family
PLN00084

?
PLN00084: PLN00084 
photosystem II subunit S (PsbS); Provisional
Statistics
?
PSSM-Id: 177707
View PSSM: PLN00084
Aligned: 2 rows
Threshold Bit Score: 340.126
Threshold Setting Gi: 255081274
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
303285790   1 MLGFFFTTVGDVVTRGEGPLEQLVDEEMFIgahassvlfhpprftlvVNHVNPYELAKDALEVAGFYVESVFVLWVTLGL 80 
255081274  92 MVGFFFTTVGDVVTRGAGPVEQLRDEQTFI-----------------MNHINPAMIAKDALEVAGIYVESVFIVWLCLAA 154
303285790  81 VFLAAVQQGnaLGKPVRTYS---SANAKAAKNGAKRVDAITAGVKEAITDVVREQRPYEVFNGRLAMLGITFAIAGDKVT 157
255081274 155 AFILAVQQG--LASPVRTYSskkSARRAELEASGERLGVMLASVKDALDVQVREQKPYELFNGRLAMLGFAFALVGEAVT 232
303285790 158 gGMGPLEQLRGETGVPVIEVELFAAFFLFGVFFNVVATGVTVGKRAWQSGKKVM 211
255081274 233 -KRGPLEQFNLETGVPVIDEELFGAFFLLGVVFNVVATGANVWKTAWAKGKSVN 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap