Conserved Protein Domain Family
PLN00083

?
PLN00083: PLN00083 
photosystem II subunit R; Provisional
Statistics
?
PSSM-Id: 177706
View PSSM: PLN00083
Aligned: 3 rows
Threshold Bit Score: 149.824
Threshold Setting Gi: 303276008
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145346793   1 MNNSSGPKRGTKSAPAQRAVGYKGSTDAGSAPKTRSGKAGYVYKLGLRNGKANVDEYSPIWVPQDFKSDGDKYEGNLVYW 80 
255083855  32 MANASGPKRGTKAQGGQAGVGYKGSTEAGSAPKTRSGKAGYVYKLGLRNGKANVDEYSPIYTPSEFKTDGDKYEGDLKLA 111
303276008  32 MANSSGPKRGTKAKGGQAGVGYKGSTEGGSAPKTRSGKAGYVYKLGLRNGKANVDEYSPIYTPEEFKTDGDKYEGDLKLA 111
145346793  81 AATLAGIIGTGALAIYLTSAL 101
255083855 112 AGAVLGVIGTGALAILATSAL 132
303276008 112 AAAVVGVVGTGALAILLTSAL 132
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap