Conserved Protein Domain Family
PLN00081

?
PLN00081: PLN00081 
photosystem I reaction center subunit V (PsaG); Provisional
Statistics
?
PSSM-Id: 165655
View PSSM: PLN00081
Aligned: 2 rows
Threshold Bit Score: 228.843
Threshold Setting Gi: 115479799
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115479799   1 MAATSLSPPTVAGLRLAPSPRvRSPSVAFRAAPArRRSVAARAELSPSLVISLSTGVSLFLGRFVFFNFQRENVAKQVPE 80 
242045112   4 STAAVLSPPSVAGLRLAPSPR-RAARVAFRAAPA-RRSVAARAELSASLVISLSTGVSLFLGRFVFFNFQRENVAKQVPA 81 
115479799  81 QNGKTHFDAGDERAKEFAGLLRSNDPVGFNLVDVLAWGSLGHIVAYYILATCSNGYNPNFF 141
242045112  82 QNGKTHFDAGDERAKEFAALLKSNDPVGFNLVDVLAWGSLGHIVAYYILATSSNGYDPNFF 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap