Conserved Protein Domain Family
PLN00078

?
PLN00078: PLN00078 
photosystem I reaction center subunit N (PsaN); Provisional
Statistics
?
PSSM-Id: 165653
View PSSM: PLN00078
Aligned: 2 rows
Threshold Bit Score: 211.867
Threshold Setting Gi: 242038245
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115455127   4 VDTIRRPfTAASTFHRSATRHLQPLAMLAQRNGISRRGLLTFLTSTAAIPEAG-ESRKALLQEYLKKSKENKEKNDKERL 82 
242038245   1 MDPITRP-VASSSFHRSAAKHLHRAVTSAQRNGVSRRCLLTLLTSTAAIPPGGsESRKALLQEYLKKSEENKEKNDKERL 79 
115455127  83 DDYYKRNYRDYFGLIEGPARQKNEDELTESEKGILEWLDKNK 124
242038245  80 DDYYKRNYKDYFGLIEGPAREKKEEERTESEKRILEWLDKNK 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap