Conserved Protein Domain Family
PLN00072

?
PLN00072: PLN00072 
3-isopropylmalate isomerase/dehydratase small subunit; Provisional
Statistics
?
PSSM-Id: 177701
View PSSM: PLN00072
Aligned: 16 rows
Threshold Bit Score: 337.216
Threshold Setting Gi: 224071511
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15231608    1 MATSQQFLNPTLFKSLASSNKNSCTLCPS-PFLQLKSASTIFNYKPLTSSSATIITRVaa--ssSDSGESITRETFHGLC 77 
115447675   1 MAAAAAAPALSLAEAAPVTAVLAPCPTPSrTFRRRSWVAAICRPALKCHHSRPLTAVVaaaaaaAAAGDSTSAGVFHGEC 80 
159476606   1 MLAAQKRAVFVQRPGRQTCVRVCAKV----------------------------------------SKKDGEPRVVRGKC 40 
168006899   1 --------------------------------------------------------------------------IIHGRC 6  
168012330   1 --------------------------------------------------------------------------VIHGKC 6  
225469374   1 MAASTASAALSGNPNLTSSHKPHASLSPHsCLRFSTAISRKFPFKSLTTIPFTTATTAas--trRSTTVTASSTSFHGLC 78 
242063054   1 ------MAAAPSATAVSTAALLAPIRAPTsAFLRRTQLTRHRDHSLKCRRAGPIVPAAaa--aaAGSSSSPSSAVFHGEC 72 
224071511   1 ---------------------------------------------------------------------------FHGHC 5  
302826721   1 ------------------------------------------------------------------MAGDTPSRQISGKC 14 
302805123   1 ------------------------------------------------------------------MAGDTPSRQISGKC 14 
15231608   78 FVLKDNIDTDQIIPAEYGTLIPSIPEDREKLGSFALNGLP-KFYNERFVVPGEMKSKYSVIIGGDNFGCGSSREHAPVCL 156
115447675  81 FVVGDNIDTDQIIPAEHLTLVPSKPDEYRKLGSFAFVGLPtAAYPTPFVAPGEETTRYAVIIGGANFGCGSSREHAPVAL 160
159476606  41 FVTKDNIDTDQIIPAEYLTLVPSKPDEYEKLGSYALIGLPdDTYTTRYVKEGEMKTEYPIIIGGQNFGCGSSREHAPVAL 120
168006899   7 FIVGDNIDTDQIIPAEYLTLVPSKPDEYEKLGSYAMIGLP--QEWGKFVEDGKMKTEYKVIIGGANFGCGSSREHAPVAL 84 
168012330   7 FVVGDNIDTDQIIPAEYLTLVPSKPEEYEKLGSYAMIGLP--AQWGKFIEDGAMKTEYKVIIGGGNFGCGSSREHAPVAL 84 
225469374  79 YVVHDNIDTDQIIPAEYLTLVPSNPDEYQKLGSYAFIGLP-SSYETRFIEAGELKTKYTIVIAGQNFGCGSSREHAPVAL 157
242063054  73 FVVGDNIDTDQIIPAEHLTLVPSKPDEYRKLGSFAFAGLPsAAYPTPFVAPGEESTRYAVVVGGANFGCGSSREHAPVAL 152
224071511   6 YVVGDNIDTDQIIPAEYLTLVPSKQEEYEKLGSYALIGLP-ATYKTRFIEANQTKTKYSIVIGGENFGCGSSREHAPVAL 84 
302826721  15 FVVRDNIDTDQIIPAEYLTLVPSKPDEYEKLGSYAMAGLP--PHYGQFMEPGKSKTKYSIIIAGSNFGCGSSREHAPVAL 92 
302805123  15 FVVRDNIDTDQIIPAEYLTLVPSKPDEYEKLGSYAMAGLP--PHYGQFMEPGKSKTKYSIIIAGSNFGCGSSREHAPVAL 92 
15231608  157 GAAGAKAVVAESYARIFFRNCVATGEIFPLE-SEVRICDECKTGDVVTIEHkedGSSLLINHTTRKEYKLKPLGDAGPVI 235
115447675 161 GAAGARAVVAEGYARIFFRNSVATGEVYPLElADTGAWKECKTGDVVTVEL---DNCVMINHTSGKQYKLKPIGDAGPVI 237
159476606 121 GAAGAKVCVAESYARIFFRNCIATGELYPCE-TTVRLCDELKTGSEVTVDM---DANVLTDHSTGKTYNLQEIGEAGPVI 196
168006899  85 GAAGCRAVVAESYARIFFRNSVATGELYPCE-TQEKIWEENHTGDYVTLDM---EKDVLVNHTTGKQYNLKPIGEAGPVI 160
168012330  85 GAAGCRAVVAESYARIFFRNSVATGELYPVE-TNGKIWEENHTGDIVTLDM---DNDVLVNHSTGKQYHLKPIGEAGPVI 160
225469374 158 GAAGARAVVAESYARIFFRNSVSTGEVYPLE-TEVRICEECRTGDVVTIEL---GESKLINHTTGKEYKLNPVGDVGPVI 233
242063054 153 GAAGARAVVAEGYARIFFRNSVATGEVYPLElTDTGAWKECKTGDVVTVDL---SNSVFINHTSGKEYKLKPIGDAGPVI 229
224071511  85 GAAGAAAVVAESYARIFFRNSVATGEIYPLE-SEVRICEECKTGDLITIEL---AESKLINHTSGKEYKLKPIGDAGPVI 160
302826721  93 GASGIQVVVAESYARIFFRNSVATGEMYPVE-CEARICDEFHNGDDVTVDM---ERDVVVNHSTGKEYALKPLGDAAPVI 168
302805123  93 GASGIQVVVAESYARIFFRNSVATGEMYPVE-CEARICDEFHNGDDVTVDM---ERDVVVNHSTGKEYALKPLGDAAPVI 168
15231608  236 DAGGIFAYARKAGMIPSA 253
115447675 238 EAGGIFAYARKTGMIASK 255
159476606 197 DAGGIFEYARRQGMIKTA 214
168006899 161 DAGGIFAYARKTGMIAS- 177
168012330 161 DAGGIFSYARSTGMIAS- 177
225469374 234 EAGGIFAYARKTGMIPAQ 251
242063054 230 EAGGIFAYARKTGMIASK 247
224071511 161 EAGGIFAYARKT------ 172
302826721 169 EAGGIFAYARQTGMIPSA 186
302805123 169 EAGGIFAYARQTGMIPSA 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap