Conserved Protein Domain Family
PLN00071

?
PLN00071: PLN00071 
photosystem I subunit VII; Provisional
Statistics
?
PSSM-Id: 177700
View PSSM: PLN00071
Aligned: 5 rows
Threshold Bit Score: 106.954
Threshold Setting Gi: 297790820
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224015823  1 MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKSGQIASSPRVEDCVGCKRCETACPTDFLSVRVYLGAETTRSLGLA 80 
224112379  1 MSHSVKIYDTCIRCIQCVQACPMDVLEMIPGDGCIAKQITSAPRTEDCVGYKRCESACPINFLSIRVYLWHEKTQSIGLF 80 
242048750  1 --------DGGIGCTQCVRACMTDVLEMIPWDGSKAKQIASAPRTEDCVGCKRCKSACPTEFLSVRVYLGPE----ISVA 68 
302824507  1 MAHPAKIHGTCIGRTQCVRACPTDVSETIPWDGCKANQIASAPRTEDRVGCKRRESACPTDPSSARVYLGSETTRSTGLA 80 
297790820  1 ---------------------------MIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLA 53 
224015823 81 Y 81 
224112379 81 Y 81 
242048750 69 Y 69 
302824507 81 H 81 
297790820 54 Y 54 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap