Conserved Protein Domain Family
PLN00068

?
PLN00068: PLN00068 
photosystem II CP47 chlorophyll A apoprotein; Provisional
Statistics
?
PSSM-Id: 177698
View PSSM: PLN00068
Aligned: 7 rows
Threshold Bit Score: 978.261
Threshold Setting Gi: 302824493
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224015794   1 MALPWYRVHTVVLNDPGRLISVHLMHTALVAGWAGSMALYELAVFDPSDPVLNPMWRQGMFVMPFMTRLGITDSWGGWSI 80 
224117092   1 MGLPWYHVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFITRLGITNSWGGWSI 80 
224104359   1 MGLPWYHVHTVVLNDPGRLLAVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFITRLGITNSWGGWSI 80 
242057453   1 ------------------------MHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWSI 56 
297840921   1 MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNI 80 
297838031   1 MGLSWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNI 80 
302824493   1 MGLPWYRAHTVVSNDPGRSLPVHLMHTALVSGWAGPMAPYELAVSDPSDPALDPMRRQGMSVIPLTTRPGVTESWSGWSI 80 
224015794  81 TGESVSNPGLWSFEGVALSHIVLSGMCFLAAIWHWVYWDLELFRDPRTGEPALDLPKIFGIHLLLSGLLCFGFGAFHVTG 160
224117092  81 TGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTG 160
224104359  81 TGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLLGVACFGFGAFHVTG 160
242057453  57 SGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTG 136
297840921  81 TGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTG 160
297838031  81 TGGTITNPGLSSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKSSLDLPKIFGIHLFLSGVACFGFGAFHVIG 160
302824493  81 AGETVTNAGIRSYEGVATAHIVPPGLLLLAAIWHWVYWDSEISSDERTGTFALDLPKISGVHPSPPGVPRFGFGASHVTG 160
224015794 161 LFGPGIWVSDAYGITGKVQPVAPSWGADGFNPFNPGGIAAHHIAAGIFGIFAGIFHLTVRPPQRLYRALRMGNIETVLSS 240
224117092 161 LYGLGIWVSDPYGLTGKLQSVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMRNIETVLSS 240
224104359 161 LYGLGIWVSDPYGLTGKLQSVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMRNIETVLSS 240
242057453 137 LYGPGIWVSDPYGLTGKVQAVNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS 216
297840921 161 LYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS 240
297838031 161 LYGPGIWVSDPYGLTGKVQPVNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS 240
302824493 161 LLGPGIWVSDPYGLTGRIEPVAPVWTAAGFDPFVPGGIASHHIAAGILGILAGLFHPSARPPQRSHKSLRMGNVETVSSS 240
224015794 241 SISAVFWAAFVTSGTMWYGAAATPIELFGPTRYQWDSGYFQQEIERQVESSVTEGLSESQAWSRIPDKLAFYDYIGNNPA 320
224117092 241 SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRKVGTGLAENQSLSEAWSKIPEKLAFYDYIGNNPA 320
224104359 241 SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRKVGTGLAENQSLSEAWSKIPEKLAFYDYIGNNPA 320
242057453 217 SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSEAWSKIPEKLAFYDYIGNNPA 296
297840921 241 SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPA 320
297838031 241 SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSEAWAKIPEKLAFYDYIGNNPA 320
302824493 241 SIAAVPLAALVVAGTMWYGSATTPVEPFGPTRYQWDLGFYQQETDRRIRSARAGNIGLPEAWSKIPEKSASHDHIGSNPA 320
224015794 321 KGGLFRSGPMDKGDGIAEAWLGHPIFRDKDGRELTVRRMPAFFETFPVILVDKDGIIRADIPFRRAESKYSIEQVGVTVD 400
224117092 321 KGGLFRAGSMDNGDGIAIGWLGHPLFRDKEGRELCVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVE 400
224104359 321 KGGLFRAGSMDNGDGIAIGWLGHPLFRDKEGRELCVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVE 400
242057453 297 KGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMPTFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVE 376
297840921 321 KGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVE 400
297838031 321 KGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMPTLFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVE 400
302824493 321 KGGSSRAGATDSGDGIAVGRLGHATPRDKEGHEPFVRRMPTLLETSPVVLVDEEGIARADVPSRRAESKYSAEQVGVTAE 400
224015794 401 FYGGKLNGQTFKDAPTVKKFARKAQLGEVFEFDRTSLESDGVFRSSPRGWYTFGHANFALLFFLGHLWHGGRTIFRDVFT 480
224117092 401 FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPKGWFTFGHASFALLFFFRHIWHGSRTLFRDVFA 480
224104359 401 FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSRRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA 480
242057453 377 FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA 456
297840921 401 FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA 480
297838031 401 FYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFHSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA 480
302824493 401 FCGGELDGVSFSDPATVKKHARRAQLGEIPESDRATSKPDGVPRSSPRGWSTFGHATFALLSSSGHIRHGARTPFRDVLA 480
224015794 481 GIGAEVTEQVEFGAFQKLGDKTTKKQGA 508
224117092 481 DIDPDLDAQVEFGAFQKLGDPTTRRQVV 508
224104359 481 GIDPDLDAQVEFGAFQKLGDPTTRRQVV 508
242057453 457 GIDPDLDAQVEFGTFQKVGDPTTRRQAA 484
297840921 481 GIDPDLDAQVEFGAFQKLGDPTTKRQAV 508
297838031 481 GIDPDLDAQVEFGAFQKLGDPTTKRQAV 508
302824493 481 GTDPDPDAQAELGTSQKSGDPTTKRQAV 508
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap